BITSTORM-HP-160-MIB

File: BITSTORM-HP-160-MIB.mib (229799 bytes)

Imported modules

ENTITY-MIB SNMPv2-TC RFC-1212
IF-MIB SNMPv2-SMI

Imported symbols

PhysicalIndex entPhysicalIndex PhysAddress
RowStatus TAddress TEXTUAL-CONVENTION
TruthValue OBJECT-TYPE ifIndex
InterfaceIndex Integer32 IpAddress
Unsigned32 NOTIFICATION-TYPE enterprises
MODULE-IDENTITY OBJECT-TYPE

Defined Types

VdslLineEntity  
Identifies a transceiver as being either Vtuc or Vtur. A VDSL line consists of two transceivers, a Vtuc and a Vtur. Attributes with this syntax reference the two sides of a line. Specified as an INTEGER, the two values are: vtuc(1) -- central site transceiver vtur(2) -- remote site transceiver
TEXTUAL-CONVENTION    
  INTEGER vtuc(1), vtur(2)  

BITSTORM-HP-160EventType  
The event type identifier number.
TEXTUAL-CONVENTION    
  INTEGER systemrestart(1), systemdownloadbegin(2), systemdownloadsuccess(3), systemdownloadfail(4), systemprovisiondataexport(5), systemprovisiondataimport(6), systemprovisiondatasetdefault(7), systemalarmlogclear(9), systemeventlogclear(10), systemrtcdatetimechange(11), systemsoftwareacobuttonset(12), systemsoftwareacobuttonclear(13), systemalarmlevelmaskflagchange(14), systemsnmpauthfail(15), systemftpreceptionstart(17), systemftpreceptioncomplete(18), systemftpreceptionincomplete(19), systemsntptimezonechange(21), systemsntpprovisionchanged(23), systemdatabasesavingfailed(25), atmcreatevcl(102), atmmodifyvcl(103), atmdeletevcl(104), atmoamcreateloopback(105), atmoamdeleteloopback(106), xdsl-port-info-changed(501), vdsl-port-binding-changed(601), vdsl-port-enabled(602), vdsl-port-disabled(603), vdsl-port-reenabled(604), vdsl-port-linkup(605), vdsl-port-linkdown(606), vdsl-line-conf-profile-created(607), vdsl-line-conf-profile-deleted(608), vdsl-line-conf-profile-changed(609), vdsl-line-alarm-conf-profile-created(610), vdsl-line-alarm-conf-profile-deleted(611), vdsl-line-alarm-conf-profile-changed(612), vdsl-port-profile-transfer-failed(613), vdsl-loopback-set(614), vdsl-delt-set(615), vdsl-delt-done(616), vdsl-perf-ne-es(651), vdsl-perf-ne-ses(652), vdsl-perf-ne-uas(653), vdsl-perf-fe-es(654), vdsl-perf-fe-ses(655), vdsl-perf-fe-uas(656), vdsl-perf-ne-day-es(657), vdsl-perf-ne-day-ses(658), vdsl-perf-ne-day-uas(659), vdsl-perf-fe-day-es(660), vdsl-perf-fe-day-ses(661), vdsl-perf-fe-day-uas(662), vdsl-down-max-snr-mgn(663), vdsl-down-min-snr-mgn(664), vdsl-up-max-snr-mgn(665), vdsl-up-min-snr-mgn(666), vdsl-init-failure-trap(667)  

MacAddress  
Tok_String
TEXTUAL-CONVENTION    
  OCTET STRING Size(6)  

BITSTORM-HP-160LedType  
LED status
TEXTUAL-CONVENTION    
  INTEGER bitstorm-hp-160ledoff(0), bitstorm-hp-160ledred(1), bitstorm-hp-160ledgreen(2), bitstorm-hp-160ledyellow(3), bitstorm-hp-160ledredflash(5), bitstorm-hp-160ledgreenflash(6), bitstorm-hp-160ledyellowflash(7)  

BITSTORM-HP-160EnetTrafficType  
Traffic Descriptor Type
TEXTUAL-CONVENTION    
  INTEGER enetpktshapingwfq(1), enetpktshapingppr(2), enetpktshapingcir(3), enetpktshapingcireir(4)  

BITSTORM-HP-160AtmTrafficType  
Atm Traffic Descriptor Type
TEXTUAL-CONVENTION    
  INTEGER atmPolicingCBR(9), atmPolicingUBR(12)  

PortList  
Each octet within this value specifies a set of eight ports, with the first octet specifying ports 1 through 8, the second octet specifying ports 9 through 16, etc. Within each octet, the most significant bit represents the lowest numbered port, and the least significant bit represents the highest numbered port. Thus, each port of the bridge is represented by a single bit within the value of this object. If that bit has a value of '1' then that port is included in the set of ports; the port is not included if its bit has a value of '0'.
TEXTUAL-CONVENTION    
  OCTET STRING  

BITSTORM-HP-160AlmType  
The alarm type identifier number.
TEXTUAL-CONVENTION    
  INTEGER sys-housekeep1(101), sys-housekeep2(102), sys-housekeep3(103), sys-housekeep4(104), sys-fan(105), sys-selftestfailed(106), sys-abovetemp(107), sys-belowtemp(108), gbe-los(201), vdsl-lof(601), vdsl-los(602), vdsl-losq(603), vdsl-lol(604), vdsl-init-failure(605), vdsl-ese(608), vdsl-ncd-slow(609), vdsl-lcd-slow(610), vdsl-ncd-fast(611), vdsl-lcd-fast(612), vdsl-lof-fe(613), vdsl-los-fe(614), vdsl-lpr-fe(615), vdsl-losq-fe(616), vdsl-no-peer-vtu-present-fe(617), vdsl-ese-fe(618), vdsl-ncd-slow-fe(619), vdsl-lcd-slow-fe(620), vdsl-ncd-fast-fe(621), vdsl-lcd-fast-fe(622)  

BITSTORM-HP-160AlmProfileEntry  
SEQUENCE    
  bitSTORM-HP-160AlmProfileTypeId BITSTORM-HP-160AlmType
  bitSTORM-HP-160AlmMask INTEGER
  bitSTORM-HP-160AlmLevelSet INTEGER

BITSTORM-HP-160AlmCurrentEntry  
SEQUENCE    
  bitSTORM-HP-160AlmCurrentEntPhyIndex PhysicalIndex
  bitSTORM-HP-160AlmCurrentIfIndex InterfaceIndex
  bitSTORM-HP-160AlmCurrentTypeId BITSTORM-HP-160AlmType
  bitSTORM-HP-160AlmCurrentLevel INTEGER
  bitSTORM-HP-160AlmCurrentState INTEGER
  bitSTORM-HP-160AlmCurrentTime OCTET STRING

BITSTORM-HP-160AlmEntry  
SEQUENCE    
  bitSTORM-HP-160AlmSeqId Integer32
  bitSTORM-HP-160AlmEntPhyIndex PhysicalIndex
  bitSTORM-HP-160AlmIfIndex InterfaceIndex
  bitSTORM-HP-160AlmTypeId BITSTORM-HP-160AlmType
  bitSTORM-HP-160AlmLevel INTEGER
  bitSTORM-HP-160AlmState INTEGER
  bitSTORM-HP-160AlmTime OCTET STRING

BITSTORM-HP-160AlmEventEntry  
SEQUENCE    
  bitSTORM-HP-160AlmEventSeqId Integer32
  bitSTORM-HP-160AlmEventEntPhyIndex PhysicalIndex
  bitSTORM-HP-160AlmEventIfIndex InterfaceIndex
  bitSTORM-HP-160AlmEventTypeId BITSTORM-HP-160EventType
  bitSTORM-HP-160AlmEventName OCTET STRING
  bitSTORM-HP-160AlmEventTime OCTET STRING

BITSTORM-HP-160CfgInbandRouteEntry  
SEQUENCE    
  bitSTORM-HP-160CfgInbandRouteIndex Integer32
  bitSTORM-HP-160CfgInbandRouteDstIp IpAddress
  bitSTORM-HP-160CfgInbandRouteNetmask IpAddress
  bitSTORM-HP-160CfgInbandRouteGateway IpAddress
  bitSTORM-HP-160CfgInbandRouteRowStatus RowStatus

BITSTORM-HP-160CfgOutbandRouteEntry  
SEQUENCE    
  bitSTORM-HP-160CfgOutbandRouteIndex Integer32
  bitSTORM-HP-160CfgOutbandRouteDstIp IpAddress
  bitSTORM-HP-160CfgOutbandRouteNetmask IpAddress
  bitSTORM-HP-160CfgOutbandRouteGateway IpAddress
  bitSTORM-HP-160CfgOutbandRouteRowStatus RowStatus

BITSTORM-HP-160CfgPhyEnetEntry  
SEQUENCE    
  bitSTORM-HP-160PhyEnetPortIndex Integer32
  bitSTORM-HP-160PhyEnetMode INTEGER
  bitSTORM-HP-160PhyEnetLinkStatus INTEGER
  bitSTORM-HP-160PhyEnetCopperFiberSelect INTEGER
  bitSTORM-HP-160PhyEnetCopperFiberStatus INTEGER

BITSTORM-HP-160BridgePortEntry  
SEQUENCE    
  bitSTORM-HP-160BridgePortIfcIndex InterfaceIndex
  bitSTORM-HP-160BridgePortDefaultVlan Integer32
  bitSTORM-HP-160BridgePortVlanPriority Integer32
  bitSTORM-HP-160BridgePortDefaultVlanTagging INTEGER
  bitSTORM-HP-160BridgePortVpmtMode INTEGER
  bitSTORM-HP-160BridgePortnodeLinkAggrMode INTEGER
  bitSTORM-HP-160BridgePortIngressMode INTEGER
  bitSTORM-HP-160BridgePortLinkMode INTEGER
  bitSTORM-HP-160BridgePortMaxMac Integer32
  bitSTORM-HP-160BridgePortAcceptableFrameType INTEGER
  bitSTORM-HP-160BridgePortIsolationMode INTEGER
  bitSTORM-HP-160BridgePortRowStatus RowStatus

BITSTORM-HP-160AgingTimeEntry  
SEQUENCE    
  bitSTORM-HP-160AgingTimeIfcIndex InterfaceIndex
  bitSTORM-HP-160AgingTime Integer32

BITSTORM-HP-160SnoopArpRequestEntry  
SEQUENCE    
  bitSTORM-HP-160SnoopArpIfcIndex InterfaceIndex
  bitSTORM-HP-160LearnByDhcp INTEGER
  bitSTORM-HP-160DefaultGatewayMac PhysAddress

BITSTORM-HP-160BridgeArpSpoofingEntry  
SEQUENCE    
  bitSTORM-HP-160ArpSpoofingIndex Integer32
  bitSTORM-HP-160ArpSpoofingBpIndex Integer32
  bitSTORM-HP-160ArpSpoofingSrcIp IpAddress
  bitSTORM-HP-160ArpSpoofingSrcMac PhysAddress
  bitSTORM-HP-160ArpSpoofingRowStatus RowStatus

BITSTORM-HP-160CfgXdslLineInfoEntry  
SEQUENCE    
  bitSTORM-HP-160CfgXdslIfIndex InterfaceIndex
  bitSTORM-HP-160CfgXdslLinePortID OCTET STRING
  bitSTORM-HP-160CfgXdslLinePortDescr OCTET STRING
  bitSTORM-HP-160CfgXdslLinePortPhoneNbr OCTET STRING

BITSTORM-HP-160CfgXdslLineEntry  
SEQUENCE    
  bitSTORM-HP-160CfgXdslIfIndex InterfaceIndex
  bitSTORM-HP-160CfgXdslLineAdminStatus INTEGER
  bitSTORM-HP-160CfgXdslLineOperStatus INTEGER

BITSTORM-HP-160CfgClusterMemberInfoEntry  
SEQUENCE    
  bitSTORM-HP-160CfgClusterMemberId Integer32
  bitSTORM-HP-160CfgClusterMemberIp TAddress
  bitSTORM-HP-160CfgClusterMemberName OCTET STRING
  bitSTORM-HP-160CfgClusterMemberState INTEGER

BITSTORM-HP-160XdslChlLEDEntry  
SEQUENCE    
  bitSTORM-HP-160xdslChlLEDStatus BITSTORM-HP-160LedType

BITSTORM-HP-160MtnFlashBackupInbandEntry  
SEQUENCE    
  bitSTORM-HP-160MtnFlashBackupInbandIndex INTEGER
  bitSTORM-HP-160MtnFlashBackupInbandEntryName OCTET STRING

BITSTORM-HP-160MtnFlashBackupGeneralEntry  
SEQUENCE    
  bitSTORM-HP-160MtnFlashBackupGeneralIndex INTEGER
  bitSTORM-HP-160MtnFlashBackupGeneralEntryName OCTET STRING

BITSTORM-HP-160MtnImageProfileEntry  
SEQUENCE    
  bitSTORM-HP-160MtnImageProfileIndex Integer32
  bitSTORM-HP-160MtnImageProfileDate OCTET STRING
  bitSTORM-HP-160MtnImageProfileVersion OCTET STRING
  bitSTORM-HP-160MtnImageProfileDisplayName OCTET STRING

BITSTORM-HP-160MtnAtmLoopbackEntry  
SEQUENCE    
  bitSTORM-HP-160MtnAtmLoopbackIfIndex InterfaceIndex
  bitSTORM-HP-160MtnAtmLoopbackId OCTET STRING
  bitSTORM-HP-160MtnAtmIfTestType INTEGER
  bitSTORM-HP-160MtnAtmIfTestState INTEGER
  bitSTORM-HP-160MtnAtmRowStatus RowStatus

BITSTORM-HP-160CfgBridgeMemberSetEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeMemberSetVlanId Integer32
  bitSTORM-HP-160CfgBridgeMemberSetEgressPorts PortList
  bitSTORM-HP-160CfgBridgeMemberSetUntaggedPorts PortList
  bitSTORM-HP-160CfgBridgeMemberSetIsolationPorts PortList
  bitSTORM-HP-160CfgBridgeMemberSetDefaultPorts PortList
  bitSTORM-HP-160CfgBridgeMemberSetRowStatus RowStatus

BITSTORM-HP-160CfgBridgeVlanListEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeVlanListPortIndex Integer32
  bitSTORM-HP-160CfgBridgeVlanListVIDs OCTET STRING

BITSTORM-HP-160CfgBridgeTpFdbEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeTpFdbId Unsigned32
  bitSTORM-HP-160CfgBridgeTpFdbMacAddress PhysAddress
  bitSTORM-HP-160CfgBridgeTpFdbReceivePort Integer32
  bitSTORM-HP-160CfgBridgeTpFdbVlan Integer32
  bitSTORM-HP-160CfgBridgeTpFdbStatus INTEGER
  bitSTORM-HP-160CfgBridgeTpFdbAgingBit INTEGER
  bitSTORM-HP-160CfgBridgeTpFdbProcessMode INTEGER
  bitSTORM-HP-160CfgBridgeTpFdbUnknownMacMode INTEGER

BITSTORM-HP-160CfgBridgeFdbStaticEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeFdbStaticId Unsigned32
  bitSTORM-HP-160CfgBridgeFdbStaticAddress OCTET STRING
  bitSTORM-HP-160CfgBridgeFdbStaticOutPort Integer32
  bitSTORM-HP-160CfgBridgeFdbStaticVlan Integer32
  bitSTORM-HP-160CfgBridgeFdbStaticrProcessMode INTEGER
  bitSTORM-HP-160CfgBridgeFdbStaticrRowStatus RowStatus

BITSTORM-HP-160CfgBridgeProtocolFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeProtocolFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeProtocolFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeProtocolFilter INTEGER
  bitSTORM-HP-160CfgBridgeProtocolFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeL4DstPortFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeL4DstPortFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeL4DstPortFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeL4DstPortFilterDestinationPort Integer32
  bitSTORM-HP-160CfgBridgeL4DstPortFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeSrcMacFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgeSrcMacFilterIndex Integer32
  bitSTORM-HP-160BridgeSrcMacFilterBpIndex InterfaceIndex
  bitSTORM-HP-160BridgeSrcMacFilterSrcMac PhysAddress
  bitSTORM-HP-160BridgeSrcMacFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeL4SrcPortFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeL4SrcPortFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeL4SrcPortFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeL4SrcPortFilterDestinationPort Integer32
  bitSTORM-HP-160CfgBridgeL4SrcPortFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeSrcIpFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgeSrcIpFilterIndex Integer32
  bitSTORM-HP-160BridgeSrcIpFilterBpIndex InterfaceIndex
  bitSTORM-HP-160BridgeSrcIpFilterSrcIpStart IpAddress
  bitSTORM-HP-160BridgeSrcIpFilterSrcIpEnd IpAddress
  bitSTORM-HP-160BridgeSrcIpFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeDstIpFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgeDstIpFilterIndex Integer32
  bitSTORM-HP-160BridgeDstIpFilterBpIndex InterfaceIndex
  bitSTORM-HP-160BridgeDstIpFilterSrcIpStart IpAddress
  bitSTORM-HP-160BridgeDstIpFilterSrcIpEnd IpAddress
  bitSTORM-HP-160BridgeDstIpFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeNetBiosFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeNetBiosFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeNetBiosFilterStatus INTEGER
  bitSTORM-HP-160CfgBridgeNetBiosFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeArpBcastFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeArpBcastFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeArpBcastFilterStatus INTEGER
  bitSTORM-HP-160CfgBridgeArpBcastFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeAllowedIpFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgeAllowedIpFilterIndex Integer32
  bitSTORM-HP-160BridgeAllowedIpFilterBpIndex InterfaceIndex
  bitSTORM-HP-160BridgeAllowedIpFilterIsDynamic INTEGER
  bitSTORM-HP-160BridgeAllowedIpFilterSrcIp IpAddress
  bitSTORM-HP-160BridgeAllowedIpFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeDstMacFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgeDstMacFilterIndex Integer32
  bitSTORM-HP-160BridgeDstMacFilterBpIndex InterfaceIndex
  bitSTORM-HP-160BridgeDstMacFilterDstMac PhysAddress
  bitSTORM-HP-160BridgeDstMacFilterRowStatus RowStatus

BITSTORM-HP-160IgmpGroupEntry  
SEQUENCE    
  bitSTORM-HP-160CfgIgmpGroupIp IpAddress
  bitSTORM-HP-160CfgIgmpGroupVlan Integer32
  bitSTORM-HP-160CfgIgmpGroupAddActions Integer32
  bitSTORM-HP-160CfgIgmpGroupNumOfEntries Integer32
  bitSTORM-HP-160CfgIgmpGroupInclude Integer32
  bitSTORM-HP-160CfgIgmpGroupBitmap OCTET STRING

BITSTORM-HP-160CfgIgmpRouterPortEntry  
SEQUENCE    
  bitSTORM-HP-160CfgIgmpRouterPortVlanId Integer32
  bitSTORM-HP-160CfgIgmpRouterPortBportIndex InterfaceIndex
  bitSTORM-HP-160CfgIgmpRouterPortBitmap InterfaceIndex
  bitSTORM-HP-160CfgIgmpRouterPortRouterIp OCTET STRING
  bitSTORM-HP-160CfgIgmpRouterPortRouterReportIp OCTET STRING
  bitSTORM-HP-160CfgIgmpRouterPortRowStatus RowStatus

BITSTORM-HP-160CfgIgmpAclProfileEntry  
SEQUENCE    
  bitSTORM-HP-160CfgIgmpAclProfileIndex Integer32
  bitSTORM-HP-160CfgIgmpAclProfileChMap OCTET STRING
  bitSTORM-HP-160CfgIgmpAclProfileVlanMap OCTET STRING
  bitSTORM-HP-160CfgIgmpAclProfileVlanEgressMap OCTET STRING
  bitSTORM-HP-160CfgIgmpAclProfileMcCount Integer32
  bitSTORM-HP-160CfgIgmpAclProfileRowStatus RowStatus
  bitSTORM-HP-160CfgIgmpAclProfileUsedCount INTEGER
  bitSTORM-HP-160CfgIgmpAclProfileMsgCount Integer32

BITSTORM-HP-160CfgIgmpBridgePortBindEntry  
SEQUENCE    
  bitSTORM-HP-160CfgIgmpBindBpId Integer32
  bitSTORM-HP-160CfgIgmpBindProfileId Integer32

BITSTORM-HP-160CfgRstpPortEntry  
SEQUENCE    
  bitSTORM-HP-160CfgRstpPortIndex Integer32
  bitSTORM-HP-160CfgRstpPortAdminEdge INTEGER
  bitSTORM-HP-160CfgRstpPortAdminPoint2Point INTEGER
  bitSTORM-HP-160CfgRstpPortAdminNonSTP INTEGER

BITSTORM-HP-160CfgDhcpDslIdConfigEntry  
SEQUENCE    
  bitSTORM-HP-160CfgDhcpDslIfIndex InterfaceIndex
  bitSTORM-HP-160CfgDslCircuitID OCTET STRING
  bitSTORM-HP-160CfgDslRemoteID OCTET STRING
  bitSTORM-HP-160CfgDslIdTrusted TruthValue
  bitSTORM-HP-160CfgDslpppoeMode INTEGER

BITSTORM-HP-160CfgDhcpServerProfileEntry  
SEQUENCE    
  bitSTORM-HP-160CfgDhcpServerPrfIndex Integer32
  bitSTORM-HP-160CfgDhcpServerPrfStartIp OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfEndIp OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfIpMsk OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfDefGatewayIp OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfDNS1Ip OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfDNS2Ip OCTET STRING
  bitSTORM-HP-160CfgDhcpServerPrfLeaseTime Integer32
  bitSTORM-HP-160CfgDhcpServerPrfUsedCount INTEGER
  bitSTORM-HP-160CfgDhcpServerPrfRowStatus RowStatus

BITSTORM-HP-160CfgDhcpServerProfileBindEntry  
SEQUENCE    
  bitSTORM-HP-160ServerBindBpIndex Integer32
  bitSTORM-HP-160ServerBindPrfIndex Integer32

BITSTORM-HP-160CfgDhcpQueryClientEntry  
SEQUENCE    
  bitSTORM-HP-160ServerQueryBpIndex Integer32
  bitSTORM-HP-160ServerQueryClientIndex Integer32
  bitSTORM-HP-160ServerQueryIp OCTET STRING
  bitSTORM-HP-160ServerQueryMac PhysAddress
  bitSTORM-HP-160ServerQueryExpTime OCTET STRING
  bitSTORM-HP-160ServerQueryLeaseTime Integer32

BITSTORM-HP-160CfgDhcpStaticIPEntry  
SEQUENCE    
  bitSTORM-HP-160StaticIndex Integer32
  bitSTORM-HP-160StaticIPBpIndex Integer32
  bitSTORM-HP-160StaticIp OCTET STRING
  bitSTORM-HP-160StaticMac PhysAddress
  bitSTORM-HP-160StaticRowStatus RowStatus

BITSTORM-HP-160CfgVpmtTrunkEntry  
SEQUENCE    
  bitSTORM-HP-160CfgVpmtIndex INTEGER
  bitSTORM-HP-160CfgVpmtPriority OCTET STRING
  bitSTORM-HP-160CfgVpmtDenyMode OCTET STRING

BITSTORM-HP-160CfgVpmtBportProfileEntry  
SEQUENCE    
  bitSTORM-HP-160CfgVpmtProfileIndex INTEGER
  bitSTORM-HP-160CfgVpmtProfilePriority OCTET STRING
  bitSTORM-HP-160CfgVpmtProfileDenyMode OCTET STRING
  bitSTORM-HP-160CfgVpmtProfileEnetProfileIndex OCTET STRING
  bitSTORM-HP-160CfgVpmtProfileUsedCount INTEGER
  bitSTORM-HP-160CfgVpmtProfileRowStatus RowStatus

BITSTORM-HP-160CfgVpmtBridgePortBindEntry  
SEQUENCE    
  bitSTORM-HP-160CfgVpmtBindBpId Integer32
  bitSTORM-HP-160CfgVpmtBindProfileId Integer32

BITSTORM-HP-160CfgEnetTrafficDescrEntry  
SEQUENCE    
  bitSTORM-HP-160CfgEnetTrafficDescrIndex Integer32
  bitSTORM-HP-160CfgEnetTrafficType BITSTORM-HP-160EnetTrafficType
  bitSTORM-HP-160CfgEnetTrafficWeight Unsigned32
  bitSTORM-HP-160CfgEnetTrafficPPR Unsigned32
  bitSTORM-HP-160CfgEnetTrafficCIR Unsigned32
  bitSTORM-HP-160CfgEnetTrafficEIR Unsigned32
  bitSTORM-HP-160CfgEnetTrafficCBS Unsigned32
  bitSTORM-HP-160CfgEnetTrafficEBS Unsigned32
  bitSTORM-HP-160CfgEnetTrafficPPRPollingSpeed Unsigned32
  bitSTORM-HP-160CfgEnetTrafficCIRPollingSpeed Unsigned32
  bitSTORM-HP-160CfgEnetTrafficEIRPollingSpeed Unsigned32
  bitSTORM-HP-160CfgAtmTrafficType BITSTORM-HP-160AtmTrafficType
  bitSTORM-HP-160CfgEnetTrafficPCR Unsigned32
  bitSTORM-HP-160CfgEnetTrafficCDVT Unsigned32
  bitSTORM-HP-160CfgEnetTrafficRowStatus RowStatus
  bitSTORM-HP-160CfgEnetTrafficUsedCount INTEGER

BITSTORM-HP-160McBcRateLimitEntry  
SEQUENCE    
  bitSTORM-HP-160McBcRateLimitVlanId Integer32
  bitSTORM-HP-160McBcRateLimitCIR Unsigned32
  bitSTORM-HP-160McBcRateLimitLbSl Unsigned32
  bitSTORM-HP-160McBcRateLimitRowStatus RowStatus

BITSTORM-HP-160McFldRateLimitEntry  
SEQUENCE    
  bitSTORM-HP-160McFldRateLimitVlanId Integer32
  bitSTORM-HP-160McFldRateLimitCIR Unsigned32
  bitSTORM-HP-160McFldRateLimitLbSl Unsigned32
  bitSTORM-HP-160McFldRateLimitRowStatus RowStatus

BITSTORM-HP-160IwPolicerEntry  
SEQUENCE    
  bitSTORM-HP-160IwPolicerIndex Integer32
  bitSTORM-HP-160IwPolicerCIR Unsigned32
  bitSTORM-HP-160IwPolicerLbSl Unsigned32
  bitSTORM-HP-160IwPolicerRowStatus RowStatus
  bitSTORM-HP-160IwPolicerUsedCount INTEGER

BITSTORM-HP-160BportRateLimitEntry  
SEQUENCE    
  bitSTORM-HP-160BportIfcIndex Integer32
  bitSTORM-HP-160BportRateLimitEgressIwPolicerIdx Unsigned32
  bitSTORM-HP-160BportRateLimitIngressIwPolicerIdx Unsigned32

BITSTORM-HP-160BportVlanRateLimitEntry  
SEQUENCE    
  bitSTORM-HP-160BportVlanRateLimitIndex Integer32
  bitSTORM-HP-160BportVlanRateLimitEgressIwPolicerIdx Unsigned32
  bitSTORM-HP-160BportVlanRateLimitIngressIwPolicerIdx Unsigned32
  bitSTORM-HP-160BportVlanRateLimitVlanId Unsigned32
  bitSTORM-HP-160BportVlanRateLimitIfcIndex Unsigned32
  bitSTORM-HP-160BportVlanRateLimitRowStatus RowStatus

BITSTORM-HP-160BportPortBcRateLimitEntry  
SEQUENCE    
  bitSTORM-HP-160bcRateBridgePortIfcIndex Integer32
  bitSTORM-HP-160bcRateLimitIngressIwPolicerIdx Integer32

BITSTORM-HP-160BportVlanTranslationEntry  
SEQUENCE    
  bitSTORM-HP-160BportVlanTranslationIndex Integer32
  bitSTORM-HP-160BportVlanTranslationUserPort Integer32
  bitSTORM-HP-160BportVlanTranslationUserVlanId Integer32
  bitSTORM-HP-160BportVlanTranslationUplinkPort Integer32
  bitSTORM-HP-160BportVlanTranslationUplinkVlanId Integer32
  bitSTORM-HP-160BportVlanTranslationUplinkPriority Integer32
  bitSTORM-HP-160BportVlanTranslationRowStatus RowStatus

BITSTORM-HP-160CfgBridgeTosVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeTosVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeTosVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeTosVpmtFilterIncomingTos Integer32
  bitSTORM-HP-160CfgBridgeTosVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeTosVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeDSVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeDSVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeDSVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeDSVpmtFilterIncomingDS Integer32
  bitSTORM-HP-160CfgBridgeDSVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeDSVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeIpSrcVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIncomingIpsrcstart IpAddress
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIncomingIpsrcend IpAddress
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeIpDstVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIncomingIpDststart IpAddress
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIncomingIpDstend IpAddress
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeIpDstVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeMacSrcVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterIncomingMacsrc PhysAddress
  bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeMacDstVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeMacDstVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeMacDstVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeMacDstVpmtFilterIncomingMacDst PhysAddress
  bitSTORM-HP-160CfgBridgeMacDstVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeMacDstVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgeVlanIdVpmtFilterEntry  
SEQUENCE    
  bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterIndex Integer32
  bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterInputBridgePort InterfaceIndex
  bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterIncomingVlanid Integer32
  bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterOutgoingVlanPriority Integer32
  bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterRowStatus RowStatus

BITSTORM-HP-160CfgBridgePrioTagFilterEntry  
SEQUENCE    
  bitSTORM-HP-160BridgePrioTagFilterIndex Integer32
  bitSTORM-HP-160BridgePrioTagInputBridgePort InterfaceIndex
  bitSTORM-HP-160BridgePrioTagOutgoingVlanPriority Integer32
  bitSTORM-HP-160BridgePrioTagIncomingVlanPriority Integer32
  bitSTORM-HP-160BridgePrioTagFilterRowStatus RowStatus

Defined Values

org 1.3
OBJECT IDENTIFIER    

dod 1.3.6
OBJECT IDENTIFIER    

internet 1.3.6.1
OBJECT IDENTIFIER    

private 1.3.6.1.4
OBJECT IDENTIFIER    

enterprises 1.3.6.1.4.1
OBJECT IDENTIFIER    

zhone 1.3.6.1.4.1.5504
OBJECT IDENTIFIER    

bitSTORM-HP-160 1.3.6.1.4.1.5504.18
Zhone IP-DSLAM root MIB module.
MODULE-IDENTITY    

bitSTORM-HP-160MibVersion 1.3.6.1.4.1.5504.18.1
This object value presents that current NE by implementation is compliant to which version the enterprise MIB belongs to.
OBJECT-TYPE    
  OCTET STRING Size(1..16)  

bitSTORM-HP-160CfgMgt 1.3.6.1.4.1.5504.18.2
OBJECT IDENTIFIER    

bitSTORM-HP-160SysMgt 1.3.6.1.4.1.5504.18.3
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnMgt 1.3.6.1.4.1.5504.18.4
OBJECT IDENTIFIER    

bitSTORM-HP-160AlmMgt 1.3.6.1.4.1.5504.18.5
OBJECT IDENTIFIER    

bitSTORM-HP-160PerfMgt 1.3.6.1.4.1.5504.18.6
OBJECT IDENTIFIER    

bitSTORM-HP-160TrapMgt 1.3.6.1.4.1.5504.18.7
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgTime 1.3.6.1.4.1.5504.18.2.1
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgAddress 1.3.6.1.4.1.5504.18.2.2
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgPhy 1.3.6.1.4.1.5504.18.2.3
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgBridge 1.3.6.1.4.1.5504.18.2.4
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgXdslSetting 1.3.6.1.4.1.5504.18.2.5
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgCLISettings 1.3.6.1.4.1.5504.18.2.6
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgCluster 1.3.6.1.4.1.5504.18.2.7
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgEnetTrafficDescrTable 1.3.6.1.4.1.5504.18.2.8
Description
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgEnetTrafficDescrEntry

bitSTORM-HP-160SysInventory 1.3.6.1.4.1.5504.18.3.1
OBJECT IDENTIFIER    

bitSTORM-HP-160LED 1.3.6.1.4.1.5504.18.3.2
OBJECT IDENTIFIER    

bitSTORM-HP-160SysTemperature 1.3.6.1.4.1.5504.18.3.3
OBJECT IDENTIFIER    

bitSTORM-HP-160SystemRestart 1.3.6.1.4.1.5504.18.4.1
Always use active(1) to restart the system.
OBJECT-TYPE    
  INTEGER active(1), ready(0)  

bitSTORM-HP-160RestartSNMPAgent 1.3.6.1.4.1.5504.18.4.2
SNMP Agent Restart. active: Restart SNMP Agent
OBJECT-TYPE    
  INTEGER active(1), ready(0)  

bitSTORM-HP-160MtnFirmware 1.3.6.1.4.1.5504.18.4.3
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnSyslog 1.3.6.1.4.1.5504.18.4.4
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnAtmOamLoopbackTest 1.3.6.1.4.1.5504.18.4.5
OBJECT IDENTIFIER    

bitSTORM-HP-160LineTestResult 1.3.6.1.4.1.5504.18.4.6
bitmap POST : Bit[1..0] --> 0:ALL PASS, 1:TESTING , 2:NO TEST, 3:FATAL ERROR Bit[ 2] Bit[12] Bit[22] BME Status --> 0:READY, 1:NA Bit[ 3] Bit[13] Bit[23] HIC Host-BME Connection Test --> 0:PASS, 1:FAIL Bit[ 4] Bit[14] Bit[24] BME Core & Mem Clk, EMI Initialization --> 0:PASS, 1:FAIL Bit[ 5] Bit[15] Bit[25] HIC PIO SDRAM Read/Write Tests --> 0:PASS, 1:FAIL Bit[ 6] Bit[16] Bit[26] SDRAM Address & Data Bus Connection Tests --> 0:PASS, 1:FAIL Bit[ 7] Bit[17] Bit[27] Memory to Memory BME DMA Tests --> 0:PASS, 1:FAIL Bit[ 8] Bit[18] Bit[28] External Memory Interface Test --> 0:PASS, 1:FAIL Bit[ 9] Bit[19] Bit[29] BME-AFE DDR Bus Connection Tests --> 0:PASS, 1:FAIL Bit[10] Bit[20] Bit[30] AFE Register Read/Write Tests --> 0:PASS, 1:FAIL Bit[11] Bit[21] Bit[31] IFE Register Read/Write Tests --> 0:PASS, 1:FAIL
OBJECT-TYPE    
  Integer32 0..4294967295  

bitSTORM-HP-160MtnCliConfig 1.3.6.1.4.1.5504.18.4.7
OBJECT IDENTIFIER    

bitSTORM-HP-160AlmMain 1.3.6.1.4.1.5504.18.5.1
OBJECT IDENTIFIER    

bitSTORM-HP-160AlmProfileTable 1.3.6.1.4.1.5504.18.5.2
Used to specify alarm log critera.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160AlmProfileEntry

bitSTORM-HP-160AlmProfileEntry 1.3.6.1.4.1.5504.18.5.2.1
An Entry in the alarm profile table.
OBJECT-TYPE    
  BITSTORM-HP-160AlmProfileEntry  

bitSTORM-HP-160AlmProfileTypeId 1.3.6.1.4.1.5504.18.5.2.1.1
The alarm type identifier number.
OBJECT-TYPE    
  BITSTORM-HP-160AlmType  

bitSTORM-HP-160AlmMask 1.3.6.1.4.1.5504.18.5.2.1.2
This object specifies an alarm for which notification generation is enabled or disabled. 0: Mask the alarm. 1: Non-mask the alarm.
OBJECT-TYPE    
  INTEGER almMask(0), almNonMask(1)  

bitSTORM-HP-160AlmLevelSet 1.3.6.1.4.1.5504.18.5.2.1.3
This object specifies the alarm level. 1: Minor 2: Major
OBJECT-TYPE    
  INTEGER almLevelMinor(1), almLevelMajor(2)  

bitSTORM-HP-160AlmCurrentTable 1.3.6.1.4.1.5504.18.5.3
The current alarm table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160AlmCurrentEntry

bitSTORM-HP-160AlmCurrentEntry 1.3.6.1.4.1.5504.18.5.3.1
An Entry in the current alarm table.
OBJECT-TYPE    
  BITSTORM-HP-160AlmCurrentEntry  

bitSTORM-HP-160AlmCurrentEntPhyIndex 1.3.6.1.4.1.5504.18.5.3.1.1
This attribute indicates the suffered entity by the entPhysicalIndex.
OBJECT-TYPE    
  PhysicalIndex 1..2147483647  

bitSTORM-HP-160AlmCurrentIfIndex 1.3.6.1.4.1.5504.18.5.3.1.2
This attribute indicates the suffered interface index by ifIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160AlmCurrentTypeId 1.3.6.1.4.1.5504.18.5.3.1.3
This attribute indicates the suffered alarm type name.
OBJECT-TYPE    
  BITSTORM-HP-160AlmType  

bitSTORM-HP-160AlmCurrentLevel 1.3.6.1.4.1.5504.18.5.3.1.4
This attribute indicates the alarm level specified by alarm profile. 1: Minor 2: Major
OBJECT-TYPE    
  INTEGER bitSTORM-HP-160AlmLevelMinor(1), bitSTORM-HP-160AlmLevelMajor(2)  

bitSTORM-HP-160AlmCurrentState 1.3.6.1.4.1.5504.18.5.3.1.5
This attribute indicates the alarm occurrence. 1: Alarm has not occurred 2: Alarm has occurred-----by current alarm table definition, this attribute will be always this value.
OBJECT-TYPE    
  INTEGER bitSTORM-HP-160AlmStateSet(1), bitSTORM-HP-160AlmStateClear(2)  

bitSTORM-HP-160AlmCurrentTime 1.3.6.1.4.1.5504.18.5.3.1.6
This attribute indicates the alarm occurence time of the current alarm table.
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160AlmTable 1.3.6.1.4.1.5504.18.5.4
The alarm log table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160AlmEntry

bitSTORM-HP-160AlmEntry 1.3.6.1.4.1.5504.18.5.4.1
An Entry in the alarm log table.
OBJECT-TYPE    
  BITSTORM-HP-160AlmEntry  

bitSTORM-HP-160AlmSeqId 1.3.6.1.4.1.5504.18.5.4.1.1
This object is used by the alarm log table to identify the row of this table. To check new row number for a new alarm occurrence, just obtain this value by bitSTORM-HP-160AlmSeqIdNext.
OBJECT-TYPE    
  Integer32 1..65535  

bitSTORM-HP-160AlmEntPhyIndex 1.3.6.1.4.1.5504.18.5.4.1.2
This attribute indicates the suffered entity by its entPhysicalIndex.
OBJECT-TYPE    
  PhysicalIndex  

bitSTORM-HP-160AlmIfIndex 1.3.6.1.4.1.5504.18.5.4.1.3
This attribute indicates the suffered interface by its ifIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160AlmTypeId 1.3.6.1.4.1.5504.18.5.4.1.4
This attribute indicates the suffered alarm type name.
OBJECT-TYPE    
  BITSTORM-HP-160AlmType  

bitSTORM-HP-160AlmLevel 1.3.6.1.4.1.5504.18.5.4.1.5
This attribute indicates the suffered alarm level defined by the alarm profile. 1: Minor 2: Major
OBJECT-TYPE    
  INTEGER bitSTORM-HP-160AlmLevelMinor(1), bitSTORM-HP-160AlmLevelMajor(2)  

bitSTORM-HP-160AlmState 1.3.6.1.4.1.5504.18.5.4.1.6
This attribute indicates the alarm occurrence or disappearance. 1: Alarm has not occurred 2: Alarm has occurred
OBJECT-TYPE    
  INTEGER bitSTORM-HP-160AlmStateSet(1), bitSTORM-HP-160AlmStateClear(2)  

bitSTORM-HP-160AlmTime 1.3.6.1.4.1.5504.18.5.4.1.7
This attributes indicates the alarm occurence time.
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160AlmSeqIdNext 1.3.6.1.4.1.5504.18.5.5
1. This object contains an appropriate value to be used for bitSTORM-HP-160AlmSeqId when creating entries in the bitSTORM-HP-160AlmTable by agent itself. 2.This indicates the next sequential number used by the alarm table.
OBJECT-TYPE    
  Integer32 1..65535  

bitSTORM-HP-160AlmEventTable 1.3.6.1.4.1.5504.18.5.6
The Event Log table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160AlmEventEntry

bitSTORM-HP-160AlmEventEntry 1.3.6.1.4.1.5504.18.5.6.1
An Entry in the Event table.
OBJECT-TYPE    
  BITSTORM-HP-160AlmEventEntry  

bitSTORM-HP-160AlmEventSeqId 1.3.6.1.4.1.5504.18.5.6.1.1
This object is used by the event table to identify the row of this table, when creating a new row in the table by SNMP Agent itself.
OBJECT-TYPE    
  Integer32 1..65535  

bitSTORM-HP-160AlmEventEntPhyIndex 1.3.6.1.4.1.5504.18.5.6.1.2
This attribute indicates the occurrence entity by entPhysicalIndex.
OBJECT-TYPE    
  PhysicalIndex  

bitSTORM-HP-160AlmEventIfIndex 1.3.6.1.4.1.5504.18.5.6.1.3
This attribute indicates the occurrence interface by ifIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160AlmEventTypeId 1.3.6.1.4.1.5504.18.5.6.1.4
This command indicates the event type name.
OBJECT-TYPE    
  BITSTORM-HP-160EventType  

bitSTORM-HP-160AlmEventName 1.3.6.1.4.1.5504.18.5.6.1.5
This attribute indicates the event name of the event table.
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160AlmEventTime 1.3.6.1.4.1.5504.18.5.6.1.6
This attribute indicates the event occurence time of the event table.
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160AlmEventSeqIdNext 1.3.6.1.4.1.5504.18.5.7
1.This object contains an appropriate value to be used for bitSTORM-HP-160AlmEventSeqId when creating entries in the bitSTORM-HP-160AlmEventTable. 2.This indicates the next sequential number used by the Event log table. 3.When wrote to 0, this indicates almLogTable will be clear.
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160AlmClear 1.3.6.1.4.1.5504.18.5.8
clear syatem alarm log.
OBJECT-TYPE    
  INTEGER active(1), ready(2)  

bitSTORM-HP-160AlmEventClear 1.3.6.1.4.1.5504.18.5.9
clear syatem event log.
OBJECT-TYPE    
  INTEGER active(1), ready(2)  

bitSTORM-HP-160Traps 1.3.6.1.4.1.5504.18.7.1
OBJECT IDENTIFIER    

bitSTORM-HP-160SysDate 1.3.6.1.4.1.5504.18.2.1.1
System date. Format: YYYY/MM/DD YYYY: Year MM: Month DD: Day 03/04/2005 is equivalent to 3/4/2005.
OBJECT-TYPE    
  OCTET STRING Size(8..10)  

bitSTORM-HP-160SysTime 1.3.6.1.4.1.5504.18.2.1.2
System time. Format: hh:mm:ss hh: hour mm: minute ss: second Use pattern like 13:03:02 instead of 13:3:2
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160SNTP 1.3.6.1.4.1.5504.18.2.1.3
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgInband 1.3.6.1.4.1.5504.18.2.2.1
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgOutband 1.3.6.1.4.1.5504.18.2.2.2
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgInbandRouteTable 1.3.6.1.4.1.5504.18.2.2.3
The Inband Route table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgInbandRouteEntry

bitSTORM-HP-160CfgInbandRouteEntry 1.3.6.1.4.1.5504.18.2.2.3.1
An Entry in the bitSTORM-HP-160CfgInbandRouteTable.
OBJECT-TYPE    
  BITSTORM-HP-160CfgInbandRouteEntry  

bitSTORM-HP-160CfgInbandRouteIndex 1.3.6.1.4.1.5504.18.2.2.3.1.1
Inband Route Index.
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgInbandRouteDstIp 1.3.6.1.4.1.5504.18.2.2.3.1.2
Inband Route Dst IP.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgInbandRouteNetmask 1.3.6.1.4.1.5504.18.2.2.3.1.3
Inband Route Netmask.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgInbandRouteGateway 1.3.6.1.4.1.5504.18.2.2.3.1.4
Inband Route Gateway.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgInbandRouteRowStatus 1.3.6.1.4.1.5504.18.2.2.3.1.5
RowStatus.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgOutbandDefaultGateway 1.3.6.1.4.1.5504.18.2.2.4
This field change will probably disconnect the current link.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgOutbandRouteTable 1.3.6.1.4.1.5504.18.2.2.5
The Outband Route table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgOutbandRouteEntry

bitSTORM-HP-160CfgOutbandRouteEntry 1.3.6.1.4.1.5504.18.2.2.5.1
An Entry Out the bitSTORM-HP-160CfgOutbandRouteTable.
OBJECT-TYPE    
  BITSTORM-HP-160CfgOutbandRouteEntry  

bitSTORM-HP-160CfgOutbandRouteIndex 1.3.6.1.4.1.5504.18.2.2.5.1.1
Outband Route Index.
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgOutbandRouteDstIp 1.3.6.1.4.1.5504.18.2.2.5.1.2
Outband Route Dst IP.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgOutbandRouteNetmask 1.3.6.1.4.1.5504.18.2.2.5.1.3
Outband Route Netmask.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgOutbandRouteGateway 1.3.6.1.4.1.5504.18.2.2.5.1.4
Outband Route Gateway.
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgOutbandRouteRowStatus 1.3.6.1.4.1.5504.18.2.2.5.1.5
RowStatus.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgPhyEnetTable 1.3.6.1.4.1.5504.18.2.3.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgPhyEnetEntry

bitSTORM-HP-160CfgPhyEnetEntry 1.3.6.1.4.1.5504.18.2.3.1.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgPhyEnetEntry  

bitSTORM-HP-160PhyEnetPortIndex 1.3.6.1.4.1.5504.18.2.3.1.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..2  

bitSTORM-HP-160PhyEnetMode 1.3.6.1.4.1.5504.18.2.3.1.1.2
Tok_String
OBJECT-TYPE    
  INTEGER autoNegotiate(1), config10MbpsHalf(2), config10MbpsFull(3), config100MbpsHalf(4), config100MbpsFull(5), other(6), unknown(7), config1000Mbps(8)  

bitSTORM-HP-160PhyEnetLinkStatus 1.3.6.1.4.1.5504.18.2.3.1.1.3
Tok_String
OBJECT-TYPE    
  INTEGER link-down(1), link-10mbpsfull(2), link-10mbpshalf(3), link-100mbpsfull(4), link-100mbpshalf(5), link-1000mbpscopper(6), link-1000mbpsfiber(7)  

bitSTORM-HP-160PhyEnetCopperFiberSelect 1.3.6.1.4.1.5504.18.2.3.1.1.4
Tok_String
OBJECT-TYPE    
  INTEGER fiber-first(0), copper-first(1)  

bitSTORM-HP-160PhyEnetCopperFiberStatus 1.3.6.1.4.1.5504.18.2.3.1.1.5
Tok_String
OBJECT-TYPE    
  INTEGER fiber(0), copper(1)  

bitSTORM-HP-160BridgePortTable 1.3.6.1.4.1.5504.18.2.4.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BridgePortEntry

bitSTORM-HP-160BridgePortEntry 1.3.6.1.4.1.5504.18.2.4.1.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BridgePortEntry  

bitSTORM-HP-160BridgePortIfcIndex 1.3.6.1.4.1.5504.18.2.4.1.1.1
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgePortDefaultVlan 1.3.6.1.4.1.5504.18.2.4.1.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160BridgePortVlanPriority 1.3.6.1.4.1.5504.18.2.4.1.1.3
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160BridgePortDefaultVlanTagging 1.3.6.1.4.1.5504.18.2.4.1.1.4
Tok_String
OBJECT-TYPE    
  INTEGER tagged(1), untagged(2)  

bitSTORM-HP-160BridgePortVpmtMode 1.3.6.1.4.1.5504.18.2.4.1.1.5
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), singleVc(1), multiVc(2)  

bitSTORM-HP-160BridgePortnodeLinkAggrMode 1.3.6.1.4.1.5504.18.2.4.1.1.6
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), enabled(1)  

bitSTORM-HP-160BridgePortIngressMode 1.3.6.1.4.1.5504.18.2.4.1.1.7
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), enabled(1)  

bitSTORM-HP-160BridgePortLinkMode 1.3.6.1.4.1.5504.18.2.4.1.1.8
Tok_String
OBJECT-TYPE    
  INTEGER user(0), uplink(1)  

bitSTORM-HP-160BridgePortMaxMac 1.3.6.1.4.1.5504.18.2.4.1.1.10
Tok_String
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160BridgePortAcceptableFrameType 1.3.6.1.4.1.5504.18.2.4.1.1.11
Tok_String
OBJECT-TYPE    
  INTEGER only-vlantagged(0), only-untagged(1), all(2)  

bitSTORM-HP-160BridgePortIsolationMode 1.3.6.1.4.1.5504.18.2.4.1.1.12
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), same(2)  

bitSTORM-HP-160BridgePortRowStatus 1.3.6.1.4.1.5504.18.2.4.1.1.13
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgVlanGroup 1.3.6.1.4.1.5504.18.2.4.2
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgFilterGroup 1.3.6.1.4.1.5504.18.2.4.3
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgLacpGroup 1.3.6.1.4.1.5504.18.2.4.4
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgIgmpGroup 1.3.6.1.4.1.5504.18.2.4.5
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgRstpGroup 1.3.6.1.4.1.5504.18.2.4.6
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgRelayGroup 1.3.6.1.4.1.5504.18.2.4.7
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgVpmtGroup 1.3.6.1.4.1.5504.18.2.4.8
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgSystemConfiguration 1.3.6.1.4.1.5504.18.2.4.9
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgLayerIIServiceOption 1.3.6.1.4.1.5504.18.2.4.13
OBJECT IDENTIFIER    

bitSTORM-HP-160AgingTimeTable 1.3.6.1.4.1.5504.18.2.4.10
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160AgingTimeEntry

bitSTORM-HP-160AgingTimeEntry 1.3.6.1.4.1.5504.18.2.4.10.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160AgingTimeEntry  

bitSTORM-HP-160AgingTimeIfcIndex 1.3.6.1.4.1.5504.18.2.4.10.1.1
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160AgingTime 1.3.6.1.4.1.5504.18.2.4.10.1.2
10..600 second
OBJECT-TYPE    
  Integer32 10..600  

bitSTORM-HP-160SnoopArpRequestTable 1.3.6.1.4.1.5504.18.2.4.11
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160SnoopArpRequestEntry

bitSTORM-HP-160SnoopArpRequestEntry 1.3.6.1.4.1.5504.18.2.4.11.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160SnoopArpRequestEntry  

bitSTORM-HP-160SnoopArpIfcIndex 1.3.6.1.4.1.5504.18.2.4.11.1.1
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160LearnByDhcp 1.3.6.1.4.1.5504.18.2.4.11.1.2
0:defaultGatewayMac is preconfigured, 1:defaultGatewayMac is learnByDhcp. Once the value is changed, the defaultGatewayMac will be cleared to FF:FF:FF:FF:FF:FF
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160DefaultGatewayMac 1.3.6.1.4.1.5504.18.2.4.11.1.3
string hex mac format in DB, example->FF:FF:FF:FF:FF:FF FF:FF:FF:FF:FF:FF means empty entry, the bport doesn't exist.
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160BridgeArpSpoofingTable 1.3.6.1.4.1.5504.18.2.4.12
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BridgeArpSpoofingEntry

bitSTORM-HP-160BridgeArpSpoofingEntry 1.3.6.1.4.1.5504.18.2.4.12.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BridgeArpSpoofingEntry  

bitSTORM-HP-160ArpSpoofingIndex 1.3.6.1.4.1.5504.18.2.4.12.1.1
Tok_String
OBJECT-TYPE    
  Integer32 0..1536  

bitSTORM-HP-160ArpSpoofingBpIndex 1.3.6.1.4.1.5504.18.2.4.12.1.2
Tok_String
OBJECT-TYPE    
  Integer32 4..219  

bitSTORM-HP-160ArpSpoofingSrcIp 1.3.6.1.4.1.5504.18.2.4.12.1.3
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160ArpSpoofingSrcMac 1.3.6.1.4.1.5504.18.2.4.12.1.4
string hex mac format in DB, example->FF:FF:FF:FF:FF:FF
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160ArpSpoofingRowStatus 1.3.6.1.4.1.5504.18.2.4.12.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgXdslLineInfoTable 1.3.6.1.4.1.5504.18.2.5.2
The Xdsl Line configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgXdslLineInfoEntry

bitSTORM-HP-160CfgXdslLineInfoEntry 1.3.6.1.4.1.5504.18.2.5.2.1
An Entry in the BITSTORM-HP-160CfgXdslLineInfoTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgXdslLineInfoEntry  

bitSTORM-HP-160CfgXdslIfIndex 1.3.6.1.4.1.5504.18.2.5.2.1.1
IfIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgXdslLinePortID 1.3.6.1.4.1.5504.18.2.5.2.1.2
The Port Identifier.
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160CfgXdslLinePortDescr 1.3.6.1.4.1.5504.18.2.5.2.1.3
The Port Description.
OBJECT-TYPE    
  OCTET STRING Size(0..48)  

bitSTORM-HP-160CfgXdslLinePortPhoneNbr 1.3.6.1.4.1.5504.18.2.5.2.1.4
The Port Phone No.
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160CfgXdslLineTable 1.3.6.1.4.1.5504.18.2.5.3
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgXdslLineEntry

bitSTORM-HP-160CfgXdslLineEntry 1.3.6.1.4.1.5504.18.2.5.3.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgXdslLineEntry  

bitSTORM-HP-160CfgXdslIfIndex 1.3.6.1.4.1.5504.18.2.5.3.1.1
IfIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgXdslLineAdminStatus 1.3.6.1.4.1.5504.18.2.5.3.1.2
The desired state of the interface. When a managed system initializes, all interfaces start with ifAdminStatus in the down(2) state.
OBJECT-TYPE    
  INTEGER up(1), down(2)  

bitSTORM-HP-160CfgXdslLineOperStatus 1.3.6.1.4.1.5504.18.2.5.3.1.3
Tok_String
OBJECT-TYPE    
  INTEGER idle(0), handshake(1), training(2), data(3), test(4), deltinit(5), deltdone(6)  

bitSTORM-HP-160CfgCLITimeout 1.3.6.1.4.1.5504.18.2.6.1
60 ~ 65535 seconds, 0 : no timeout 1 ~ 59 is not allowed.
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160CfgClusterConfig 1.3.6.1.4.1.5504.18.2.7.1
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgClusterMemberInfoTable 1.3.6.1.4.1.5504.18.2.7.2
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgClusterMemberInfoEntry

bitSTORM-HP-160CfgClusterMemberInfoEntry 1.3.6.1.4.1.5504.18.2.7.2.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgClusterMemberInfoEntry  

bitSTORM-HP-160CfgClusterMemberId 1.3.6.1.4.1.5504.18.2.7.2.1.1
Tok_String
OBJECT-TYPE    
  Integer32 -2147483648..2147483647  

bitSTORM-HP-160CfgClusterMemberIp 1.3.6.1.4.1.5504.18.2.7.2.1.2
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgClusterMemberName 1.3.6.1.4.1.5504.18.2.7.2.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160CfgClusterMemberState 1.3.6.1.4.1.5504.18.2.7.2.1.4
Tok_String
OBJECT-TYPE    
  INTEGER slave(0), master(1)  

bitSTORM-HP-160SysInvSWVersion 1.3.6.1.4.1.5504.18.3.1.1
The software version of the system.
OBJECT-TYPE    
  OCTET STRING Size(1..30)  

bitSTORM-HP-160SysInvFWVersion 1.3.6.1.4.1.5504.18.3.1.2
The firmware version of the system.
OBJECT-TYPE    
  OCTET STRING Size(1..30)  

bitSTORM-HP-160SysInvHWVersion 1.3.6.1.4.1.5504.18.3.1.3
The hardware version of the system.
OBJECT-TYPE    
  OCTET STRING Size(1..30)  

bitSTORM-HP-160SysInvModelInfo 1.3.6.1.4.1.5504.18.3.1.4
Model information.
OBJECT-TYPE    
  OCTET STRING Size(1..15)  

bitSTORM-HP-160SysInvPartNbr 1.3.6.1.4.1.5504.18.3.1.5
Part Nbr.
OBJECT-TYPE    
  OCTET STRING Size(1..15)  

bitSTORM-HP-160SysInvHWRev 1.3.6.1.4.1.5504.18.3.1.6
Hardware Rev.
OBJECT-TYPE    
  OCTET STRING Size(1..8)  

bitSTORM-HP-160SysInvSerialNum 1.3.6.1.4.1.5504.18.3.1.7
The serial number string for the system.
OBJECT-TYPE    
  OCTET STRING Size(1..30)  

bitSTORM-HP-160SysInvSplitterType 1.3.6.1.4.1.5504.18.3.1.8
ETSI270-POTS-Splitter(0), ANSI600-POTS-Splitter(1), ANSI900-POTS-Splitter(2), ISDN-Splitter(4), No-Splitter(7)
OBJECT-TYPE    
  INTEGER etsi270-pots-splitter(0), ansi600-pots-splitter(1), ansi900-pots-splitter(2), isdn-splitter(4), no-splitter(7)  

bitSTORM-HP-160SysInvCPLDVersion 1.3.6.1.4.1.5504.18.3.1.9
The cpld version of the system card.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160SysInvCardType 1.3.6.1.4.1.5504.18.3.1.10
The card type of the system card.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160SysInvBootLoaderVersion 1.3.6.1.4.1.5504.18.3.1.11
The winmon version.
OBJECT-TYPE    
  OCTET STRING Size(1..16)  

bitSTORM-HP-160SysInvPortCount 1.3.6.1.4.1.5504.18.3.1.12
Port count.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160SysSysFanSupported 1.3.6.1.4.1.5504.18.3.4
Tok_String
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160SysLED 1.3.6.1.4.1.5504.18.3.2.1
System LED status of the DSLAM. Normal operation: bitSTORM-HP-160LedGreen(2) Self-test fail : bitSTORM-HP-160LedRed(1) Power on : bitSTORM-HP-160LedYellow(3)
OBJECT-TYPE    
  BITSTORM-HP-160LedType  

bitSTORM-HP-160AlmLED 1.3.6.1.4.1.5504.18.3.2.2
Alarm LED status for bitSTORM-HP-160 of the DSLAM. Normal operation : bitSTORM-HP-160LedGreen(2) Major alarm set : bitSTORM-HP-160LedRed(1) Minor alarm set : bitSTORM-HP-160LedYellow(3) Major and minor alarm set: bitSTORM-HP-160LedRedFlash(5) Power on : bitSTORM-HP-160LedYellow(3)
OBJECT-TYPE    
  BITSTORM-HP-160LedType  

bitSTORM-HP-160Gbe1LED 1.3.6.1.4.1.5504.18.3.2.3
GbE1 LED status for bitSTORM-HP-160 of the DSLAM. Normal operation : bitSTORM-HP-160LedGreen(2)
OBJECT-TYPE    
  BITSTORM-HP-160LedType  

bitSTORM-HP-160Gbe2LED 1.3.6.1.4.1.5504.18.3.2.4
GbE2 LED status for bitSTORM-HP-160 of the DSLAM. Normal operation : bitSTORM-HP-160LedGreen(2)
OBJECT-TYPE    
  BITSTORM-HP-160LedType  

bitSTORM-HP-160XdslChlLEDTable 1.3.6.1.4.1.5504.18.3.2.5
The Channel Led table of system.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160XdslChlLEDEntry

bitSTORM-HP-160XdslChlLEDEntry 1.3.6.1.4.1.5504.18.3.2.5.1
An Entry in the Channel Led table. Support 24 channel.
OBJECT-TYPE    
  BITSTORM-HP-160XdslChlLEDEntry  

bitSTORM-HP-160xdslChlLEDStatus 1.3.6.1.4.1.5504.18.3.2.5.1.1
The LED Status of xDSL Channel Port Normal operation : bitSTORM-HP-160LedGreen (2) Port training : bitSTORM-HP-160LedGreenFlash (6) Port not provisioned : bitSTORM-HP-160LedOff (0)
OBJECT-TYPE    
  BITSTORM-HP-160LedType  

bitSTORM-HP-160SysTemperatureUpShfThreshold 1.3.6.1.4.1.5504.18.3.3.1
If current temperature exceeds bitSTORM-HP-160SysTemperatureUpShfThreshold, Alarm Manager will declare that there is a high temperature alarm after bitSTORM-HP-160SysTemperatureUpShfTime seconds.
OBJECT-TYPE    
  Integer32 -55..85  

bitSTORM-HP-160SysTemperatureDwShfThreshold 1.3.6.1.4.1.5504.18.3.3.2
If current temperature descends below to bitSTORM-HP-160SysTemperatureDwShfThreshold, Alarm Manager will declare that there is a lower temperature alarm after bitSTORM-HP-160SysTemperatureDwShfTime seconds.
OBJECT-TYPE    
  Integer32 -55..85  

bitSTORM-HP-160SysTemperatureUpShfTime 1.3.6.1.4.1.5504.18.3.3.3
The bitSTORM-HP-160SysTemperatureUpShfTime will start to count when bitSTORM-HP-160SysTemperatureValue excessing bitSTORM-HP-160SysTemperatureUpShfThreshold.
OBJECT-TYPE    
  Integer32 1..255  

bitSTORM-HP-160SysTemperatureDwShfTime 1.3.6.1.4.1.5504.18.3.3.4
The bitSTORM-HP-160SysTemperatureDwShfTime will start to count when bitSTORM-HP-160SysTemperatureValue excessing bitSTORM-HP-160SysTemperatureDwShfThreshold.
OBJECT-TYPE    
  Integer32 1..255  

bitSTORM-HP-160SysTemperatureaFanThreshold 1.3.6.1.4.1.5504.18.3.3.5
If Fan temperature exceeds bitSTORM-HP-160SysTemperatureaFanThreshold, Fan will be turned on.
OBJECT-TYPE    
  Integer32 -40..15  

bitSTORM-HP-160SysTemperatureValue 1.3.6.1.4.1.5504.18.3.3.6
The current temperature value.
OBJECT-TYPE    
  Integer32 -55..125  

bitSTORM-HP-160SysTemperatureDslValue 1.3.6.1.4.1.5504.18.3.3.7
The DSL temperature value.
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160MtnRemoteFTPServer 1.3.6.1.4.1.5504.18.4.3.1
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnCliCfgFTPServer 1.3.6.1.4.1.5504.18.4.7.1
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnCliCfgInbandIndex 1.3.6.1.4.1.5504.18.4.7.2
Tok_String
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160MtnCliCfgGeneralIndex 1.3.6.1.4.1.5504.18.4.7.3
Tok_String
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160MtnCliCfgInbandBackupName 1.3.6.1.4.1.5504.18.4.7.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160MtnCliCfgGeneralBackupName 1.3.6.1.4.1.5504.18.4.7.5
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160MtnCliCfgActionType 1.3.6.1.4.1.5504.18.4.7.6
Action to be taken: CLICONFIG-SAVE: Save database to flash Use cliCfgBackupNameInband with MASK_cliCfgBackupNameInband to specify name for inband database. Use cliCfgBackupNameGeneral with MASK_cliCfgBackupNameGeneral to specify name for general database. -- CLICONFIG-LOAD-NVRAM: -- Load database from flash (used by OAMP internally) -- CLICONFIG-LOAD-INTERNAL: -- Load database from flash (used by OAMP internally) -- CLICONFIG-RESTORE-BY-NAME: -- Restore database with the specific names -- Use cliCfgBackupNameInband with MASK_cliCfgBackupNameInband to specify name for inband database. -- Use cliCfgBackupNameGeneral with MASK_cliCfgBackupNameGeneral to specify name for general database. CLICONFIG-RESTORE-BY-INDEX: Restore database with the specific indexes Use cliCfgParam1 with MASK_cliCfgParam1 to specify index for inband database. Use cliCfgParam2 with MASK_cliCfgParam2 to specify index for general database. CLICONFIG-CLEAR-ALL: Clear Inband/General database CLICONFIG-CLEAR-GENERAL: Clear General database CLICONFIG-EXPORT-BINARY: Export database (binary) -- CLICONFIG-EXPORT-TEXT: -- Export database (text) CLICONFIG-EXPORT-CLI: Export database as a CLI script (gbe ip/netmask,route not exported) CLICONFIG-GET-BINARY: Get binary database image from a FTP server. CLICONFIG-GET-CLI: Get CLI script from a FTP server. CLICONFIG-PUT-BINARY: Put binary database image to a FTP server. CLICONFIG-PUT-CLI: Put CLI script to a FTP server. -- CLICONFIG-IMPORT-BINARY: -- Import from binary database images -- CLICONFIG-IMPORT-CLI: -- Import from a CLI script CLICONFIG-IMPORT-DOWNLOAD-BINARY: As previous CLICONFIG-WRITE-DOWNLOAD. Import from downloaded binary images. CLICONFIG-IMPORT-DOWNLOAD-CLI: Import from download CLI script. CLICONFIG-CHANGE-DETECT Detect database changes, for agents.
OBJECT-TYPE    
  INTEGER cliconfig-save(1), cliconfig-restore-by-index(5), cliconfig-clear-all(6), cliconfig-clear-general(7), cliconfig-export-binary(8), cliconfig-export-cli(10), cliconfig-get-binary(11), cliconfig-get-cli(12), cliconfig-put-binary(13), cliconfig-put-cli(14), cliconfig-import-download-binary(17), cliconfig-import-download-cli(18), cliconfig-change-detect(21)  

bitSTORM-HP-160MtnCliCfgStatus 1.3.6.1.4.1.5504.18.4.7.7
This object is to report the cli configuration status aftert config action.
OBJECT-TYPE    
  INTEGER ftpputsuccess(1), ftpputfail(2), ftpputinprogress(3), ftpgetsuccess(4), ftpgetfail(5), ftpgetinprogress(6), memorywritesuccess(7), memorywritefail(8), memorywriteinprogress(9), memoryreadsuccess(10), memoryreadfail(11), memoryreadinprogress(12)  

bitSTORM-HP-160MtnCliCfgConfigUnsaved 1.3.6.1.4.1.5504.18.4.7.8
Must set bitSTORM-HP-160MtnCliCfgActionType to CLICONFIG-CHANGE-DETECT(21). After bitSTORM-HP-160MtnCliCfgStatus is changed to MEMORYWRITESUCCESS(7), this field is non-zero if there are unsaved database changes.
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160MtnFlashBackup 1.3.6.1.4.1.5504.18.4.8
OBJECT IDENTIFIER    

bitSTORM-HP-160MtnFlashBackupInbandTable 1.3.6.1.4.1.5504.18.4.8.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160MtnFlashBackupInbandEntry

bitSTORM-HP-160MtnFlashBackupInbandEntry 1.3.6.1.4.1.5504.18.4.8.1.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160MtnFlashBackupInbandEntry  

bitSTORM-HP-160MtnFlashBackupInbandIndex 1.3.6.1.4.1.5504.18.4.8.1.1.1
Tok_String
OBJECT-TYPE    
  INTEGER 1..16  

bitSTORM-HP-160MtnFlashBackupInbandEntryName 1.3.6.1.4.1.5504.18.4.8.1.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(1..32)  

bitSTORM-HP-160MtnFlashBackupGeneralTable 1.3.6.1.4.1.5504.18.4.8.2
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160MtnFlashBackupGeneralEntry

bitSTORM-HP-160MtnFlashBackupGeneralEntry 1.3.6.1.4.1.5504.18.4.8.2.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160MtnFlashBackupGeneralEntry  

bitSTORM-HP-160MtnFlashBackupGeneralIndex 1.3.6.1.4.1.5504.18.4.8.2.1.1
Tok_String
OBJECT-TYPE    
  INTEGER 1..16  

bitSTORM-HP-160MtnFlashBackupGeneralEntryName 1.3.6.1.4.1.5504.18.4.8.2.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(1..32)  

bitSTORM-HP-160MtnFlashBackupInbandActiveIndex 1.3.6.1.4.1.5504.18.4.8.3
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160MtnFlashBackupGeneralActiveIndex 1.3.6.1.4.1.5504.18.4.8.4
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160MtnFlashWrite 1.3.6.1.4.1.5504.18.4.3.2
Set this object to active, the system will get image file via ftp and then write the new firmware to the flash and restart itself. Get this object to know the status. The values for setting operations are as follows. 1: ACTIVE(1) The value for status/read operations are as follows: 2: FTPSUCCESS(2) 3: FTPFAIL(3) 4: FTPINPROGRESS(4) 5: FLASHWRITESUCCES(5) 6: FLASHWRITEFAIL(6) 7: FLASHWRITEINPROG(7)
OBJECT-TYPE    
  INTEGER idle(0), active(1), ftpsuccess(2), ftpfail(3), ftpinprogress(4), flashwritesucces(5), flashwritefail(6), flashwriteinprog(7)  

bitSTORM-HP-160MtnBootLoaderUpdate 1.3.6.1.4.1.5504.18.4.3.3
Set this object to active, the system will get bootloader file via ftp and then write the new bootloader to the flash and restart itself. Get this object to know the status. The values for setting operations are as follows. 1: ACTIVE(1) The value for status/read operations are as follows: 2: FTPSUCCESS(2) 3: FTPFAIL(3) 4: FTPINPROGRESS(4) 5: BOOTLOADERWRITESUCCES(5) 6: BOOTLOADERWRITEFAIL(6) 7: BOOTLOADERWRITEINPROG(7)
OBJECT-TYPE    
  INTEGER idle(0), active(1), ftpsuccess(2), ftpfail(3), ftpinprogress(4), bootloadercodewritesucces(5), bootloaderwritefail(6), bootloaderwriteinprog(7)  

bitSTORM-HP-160MtnImageProfileTable 1.3.6.1.4.1.5504.18.4.3.4
The Flash Image Profile table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160MtnImageProfileEntry

bitSTORM-HP-160MtnImageProfileEntry 1.3.6.1.4.1.5504.18.4.3.4.1
An Entry in the ImageProfile table.
OBJECT-TYPE    
  BITSTORM-HP-160MtnImageProfileEntry  

bitSTORM-HP-160MtnImageProfileIndex 1.3.6.1.4.1.5504.18.4.3.4.1.1
If current temperature exceeds bitSTORM-HP-160SysTemperatureUpShfThreshold, Alarm Manager will declare that there is a high temperature alarm after bitSTORM-HP-160SysTemperatureUpShfTime seconds.
OBJECT-TYPE    
  Integer32 0..1  

bitSTORM-HP-160MtnImageProfileDate 1.3.6.1.4.1.5504.18.4.3.4.1.2
Flash image date.
OBJECT-TYPE    
  OCTET STRING Size(1..16)  

bitSTORM-HP-160MtnImageProfileVersion 1.3.6.1.4.1.5504.18.4.3.4.1.3
Flash image version.
OBJECT-TYPE    
  OCTET STRING Size(1..16)  

bitSTORM-HP-160MtnImageProfileDisplayName 1.3.6.1.4.1.5504.18.4.3.4.1.4
Flash image display name.
OBJECT-TYPE    
  OCTET STRING Size(1..32)  

bitSTORM-HP-160MtnActivePartition 1.3.6.1.4.1.5504.18.4.3.5
This object is to select the partition which is active.
OBJECT-TYPE    
  INTEGER partition0(0), partition1(1)  

bitSTORM-HP-160MtnSyslogService 1.3.6.1.4.1.5504.18.4.4.1
Syslog Service On/Off. enable: service on disable: service off
OBJECT-TYPE    
  INTEGER enable(1), disable(2)  

bitSTORM-HP-160MtnSyslogServerIP 1.3.6.1.4.1.5504.18.4.4.2
The Syslog Server IP.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160MtnSyslogMaxFileSize 1.3.6.1.4.1.5504.18.4.4.3
The maximum size of the log file for syslog. (16 ~ 1024 KB).
OBJECT-TYPE    
  INTEGER 16..1024  

bitSTORM-HP-160MtnOAMCellGeneration 1.3.6.1.4.1.5504.18.4.5.1
Tok_String
OBJECT-TYPE    
  INTEGER enable(1), disable(0)  

bitSTORM-HP-160MtnAtmLoopbackTable 1.3.6.1.4.1.5504.18.4.5.2
The Atm Loopback table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160MtnAtmLoopbackEntry

bitSTORM-HP-160MtnAtmLoopbackEntry 1.3.6.1.4.1.5504.18.4.5.2.1
An Entry in the AtmLoopback table.
OBJECT-TYPE    
  BITSTORM-HP-160MtnAtmLoopbackEntry  

bitSTORM-HP-160MtnAtmLoopbackIfIndex 1.3.6.1.4.1.5504.18.4.5.2.1.1
AtmLoopback IfIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160MtnAtmLoopbackId 1.3.6.1.4.1.5504.18.4.5.2.1.2
AtmLoopback Id.
OBJECT-TYPE    
  OCTET STRING Size(1..32)  

bitSTORM-HP-160MtnAtmIfTestType 1.3.6.1.4.1.5504.18.4.5.2.1.3
Atm If Test Type.
OBJECT-TYPE    
  INTEGER vce2e(2), vcsegment(3)  

bitSTORM-HP-160MtnAtmIfTestState 1.3.6.1.4.1.5504.18.4.5.2.1.4
Atm If Test State.
OBJECT-TYPE    
  INTEGER idle(0), inprogess(1), fail(2), success(3)  

bitSTORM-HP-160MtnAtmRowStatus 1.3.6.1.4.1.5504.18.4.5.2.1.5
Atm If RowStatus.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160SysAlmStatus 1.3.6.1.4.1.5504.18.5.1.1
Indicates current system-level alarm state. This is a bit-map of possible conditions. The various bit positions from left to right are: 17 housekeep1Alarm Housekeeping pin 1 detect an alarm input. 18 housekeep2Alarm Housekeeping pin 2 detect an alarm input. 19 housekeep3Alarm Housekeeping pin 3 detect an alarm input. 20 housekeep4Alarm Housekeeping pin 4 detect an alarm input. 21 fanAlarm Fan module reports fan failure. 22 selftestFailAlarm A module reports self-test failure. 23 aboveTempAlarm Temperature above normal. 24 belowTempAlarm Temperature below normal.
OBJECT-TYPE    
  BITS housekeep1Alarm(17), housekeep2Alarm(18), housekeep3Alarm(19), housekeep4Alarm(20), fanAlarm(21), selftestFailAlarm(22), aboveTempAlarm(23), belowTempAlarm(24)  

bitSTORM-HP-160AlmMajorAlmStatus 1.3.6.1.4.1.5504.18.5.1.2
Major alarm state is detected or not. 0: No major alarm detected 1: Major alarms detected
OBJECT-TYPE    
  INTEGER majorAlmStatusClear(0), majorAlmStatusSet(1)  

bitSTORM-HP-160AlmMinorAlmStatus 1.3.6.1.4.1.5504.18.5.1.3
Minor alarm state is detected or not. 0: No minor alarm detected 1: Minor alarms detected
OBJECT-TYPE    
  INTEGER minorAlmStatusClear(0), minorAlmStatusSet(1)  

bitSTORM-HP-160AlmCutOff 1.3.6.1.4.1.5504.18.5.1.4
This command allows the ACO to be activated. 0: Alarm cutoff deactive (only for read, not for write) 1: Alarm cutoff active
OBJECT-TYPE    
  INTEGER acoDeactive(0), acoActive(1)  

bitSTORM-HP-160TrapAlarmPrefix 1.3.6.1.4.1.5504.18.7.1.1
OBJECT IDENTIFIER    

bitSTORM-HP-160TrapEventPrefix 1.3.6.1.4.1.5504.18.7.1.2
OBJECT IDENTIFIER    

bitSTORM-HP-160SNTPTimeZone 1.3.6.1.4.1.5504.18.2.1.3.1
This command is used to set the time zone. The CCT is +8 relative to Greenwich mean time (GMT). This field change will probably end up with time change too.
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160SNTPPollingInterval 1.3.6.1.4.1.5504.18.2.1.3.2
This command sets the SNTP client to automatically send a time synchronization request (specific to the mode) to the network at a specific interval. If the poll-interval is set to 0, the polling mechanism will be disabled.
OBJECT-TYPE    
  Integer32 60..65535  

bitSTORM-HP-160SNTPServerIP 1.3.6.1.4.1.5504.18.2.1.3.3
This command is used to set the dedicated unicast server ipaddress for the SNTP client.
OBJECT-TYPE    
  TAddress Size(1..255)  

bitSTORM-HP-160SNTPSynchronize 1.3.6.1.4.1.5504.18.2.1.3.4
Always use active(1) to do SNTP Synchronization.
OBJECT-TYPE    
  INTEGER active(1), ready(0)  

bitSTORM-HP-160CfgInbandIPAddress 1.3.6.1.4.1.5504.18.2.2.1.1
This field change will probably disconnect the current link.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgInbandSubnetMask 1.3.6.1.4.1.5504.18.2.2.1.2
This field change will probably disconnect the current link.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgInbandMACAddress 1.3.6.1.4.1.5504.18.2.2.1.3
This field can't be changed.
OBJECT-TYPE    
  TAddress Size(1..255)  

bitSTORM-HP-160CfgInbandManageVlanId 1.3.6.1.4.1.5504.18.2.2.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..4094  

bitSTORM-HP-160CfgInbandManagePriority 1.3.6.1.4.1.5504.18.2.2.1.5
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgOutbandIPAddress 1.3.6.1.4.1.5504.18.2.2.2.1
This field change will probably disconnect the current link.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgOutbandSubnetMask 1.3.6.1.4.1.5504.18.2.2.2.2
This field change will probably disconnect the current link.
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgBridgeMemberSetTable 1.3.6.1.4.1.5504.18.2.4.2.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeMemberSetEntry

bitSTORM-HP-160CfgBridgeMemberSetEntry 1.3.6.1.4.1.5504.18.2.4.2.1.1
the ports for a specific VLAN
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeMemberSetEntry  

bitSTORM-HP-160CfgBridgeMemberSetVlanId 1.3.6.1.4.1.5504.18.2.4.2.1.1.1
The identity of MemberSet.
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeMemberSetEgressPorts 1.3.6.1.4.1.5504.18.2.4.2.1.1.2
28 Bytes for bridge port 0~219.
OBJECT-TYPE    
  PortList  

bitSTORM-HP-160CfgBridgeMemberSetUntaggedPorts 1.3.6.1.4.1.5504.18.2.4.2.1.1.3
28 Bytes for bridge port 0~219.
OBJECT-TYPE    
  PortList  

bitSTORM-HP-160CfgBridgeMemberSetIsolationPorts 1.3.6.1.4.1.5504.18.2.4.2.1.1.4
28 Bytes for bridge port 0~219.
OBJECT-TYPE    
  PortList  

bitSTORM-HP-160CfgBridgeMemberSetDefaultPorts 1.3.6.1.4.1.5504.18.2.4.2.1.1.5
28 Bytes for bridge port 0~219.
OBJECT-TYPE    
  PortList  

bitSTORM-HP-160CfgBridgeMemberSetRowStatus 1.3.6.1.4.1.5504.18.2.4.2.1.1.6
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeVlanListTable 1.3.6.1.4.1.5504.18.2.4.2.2
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeVlanListEntry

bitSTORM-HP-160CfgBridgeVlanListEntry 1.3.6.1.4.1.5504.18.2.4.2.2.1
the VLANs for a specific port
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeVlanListEntry  

bitSTORM-HP-160CfgBridgeVlanListPortIndex 1.3.6.1.4.1.5504.18.2.4.2.2.1.1
The identity of VlanList.
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeVlanListVIDs 1.3.6.1.4.1.5504.18.2.4.2.2.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgBridgeTpFdbTable 1.3.6.1.4.1.5504.18.2.4.2.3
A table containing filtering information for Unicast MAC addresses for each Filtering Database, configured into the device by (local or network) management specifying the set of ports to which frames received from specific ports and containing specific unicast destination addresses are allowed to be forwarded. A value of zero in this table as the port number from which frames with a specific destination address are received, is used to specify all ports for which there is no specific entry in this table for that particular destination address. Entries are valid for unicast addresses only.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeTpFdbEntry

bitSTORM-HP-160CfgBridgeTpFdbEntry 1.3.6.1.4.1.5504.18.2.4.2.3.1
Filtering information configured into the device by (local or network) management specifying the set of ports to which frames received from a specific port and containing a specific unicast destination address are allowed to be forwarded.
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeTpFdbEntry  

bitSTORM-HP-160CfgBridgeTpFdbId 1.3.6.1.4.1.5504.18.2.4.2.3.1.1
The identity of this Filtering Database.
OBJECT-TYPE    
  Unsigned32  

bitSTORM-HP-160CfgBridgeTpFdbMacAddress 1.3.6.1.4.1.5504.18.2.4.2.3.1.2
The destination MAC address in a frame to which this entry's filtering information applies. This object must take the value of a unicast address.
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160CfgBridgeTpFdbReceivePort 1.3.6.1.4.1.5504.18.2.4.2.3.1.3
Either the value '0', or the port number of the port from which a frame must be received in order for this entry's filtering information to apply. A value of zero indicates that this entry applies on all ports of the device for which there is no other applicable entry.
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160CfgBridgeTpFdbVlan 1.3.6.1.4.1.5504.18.2.4.2.3.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..4094  

bitSTORM-HP-160CfgBridgeTpFdbStatus 1.3.6.1.4.1.5504.18.2.4.2.3.1.5
Tok_String
OBJECT-TYPE    
  INTEGER static(0), dynamic(1), admin(2)  

bitSTORM-HP-160CfgBridgeTpFdbAgingBit 1.3.6.1.4.1.5504.18.2.4.2.3.1.6
Tok_String
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160CfgBridgeTpFdbProcessMode 1.3.6.1.4.1.5504.18.2.4.2.3.1.7
Tok_String
OBJECT-TYPE    
  INTEGER pass(0), deny(1), direct-term(2), res-mc-term(3), svl-uc-pass(4)  

bitSTORM-HP-160CfgBridgeTpFdbUnknownMacMode 1.3.6.1.4.1.5504.18.2.4.2.3.1.8
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), unitcast(1), multicast(2)  

bitSTORM-HP-160CfgBridgeFdbStaticTable 1.3.6.1.4.1.5504.18.2.4.2.4
A table containing filtering information for Multicast and Broadcast MAC addresses for each VLAN, configured into the device by (local or network) management specifying the set of ports to which frames received from specific ports and containing specific Multicast and Broadcast destination addresses are allowed to be forwarded. A value of zero in this table as the port number from which frames with a specific destination address are received, is used to specify all ports for which there is no specific entry in this table for that particular destination address. Entries are valid for Multicast and Broadcast addresses only.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeFdbStaticEntry

bitSTORM-HP-160CfgBridgeFdbStaticEntry 1.3.6.1.4.1.5504.18.2.4.2.4.1
Filtering information configured into the device by (local or network) management specifying the set of ports to which frames received from this specific port for this VLAN and containing this Multicast or Broadcast destination address are allowed to be forwarded.
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeFdbStaticEntry  

bitSTORM-HP-160CfgBridgeFdbStaticId 1.3.6.1.4.1.5504.18.2.4.2.4.1.1
The identity of this Filtering Database.
OBJECT-TYPE    
  Unsigned32  

bitSTORM-HP-160CfgBridgeFdbStaticAddress 1.3.6.1.4.1.5504.18.2.4.2.4.1.2
The destination MAC address in a frame to which this entry's filtering information applies. This object must take the value of a Multicast or Broadcast address.
OBJECT-TYPE    
  OCTET STRING Size(17)  

bitSTORM-HP-160CfgBridgeFdbStaticOutPort 1.3.6.1.4.1.5504.18.2.4.2.4.1.3
Either the value '0', or the port number of the port from which a frame must be received in order for this entry's filtering information to apply. A value of zero indicates that this entry applies on all ports of the device for which there is no other applicable entry.
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160CfgBridgeFdbStaticVlan 1.3.6.1.4.1.5504.18.2.4.2.4.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..4094  

bitSTORM-HP-160CfgBridgeFdbStaticrProcessMode 1.3.6.1.4.1.5504.18.2.4.2.4.1.5
Tok_String
OBJECT-TYPE    
  INTEGER deny(0), pass(1)  

bitSTORM-HP-160CfgBridgeFdbStaticrRowStatus 1.3.6.1.4.1.5504.18.2.4.2.4.1.6
The status of this bitSTORM-HP-160CfgBridgeFdbStaticEntry entry.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgRateLimitGroup 1.3.6.1.4.1.5504.18.2.4.2.6
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgVlanPriorityGroup 1.3.6.1.4.1.5504.18.2.4.2.7
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgBridgeProtocolFilterTable 1.3.6.1.4.1.5504.18.2.4.3.1
The Protocol filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeProtocolFilterEntry

bitSTORM-HP-160CfgBridgeProtocolFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.1.1
An Entry in the bitSTORM-HP-160CfgBridgeProtocolFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeProtocolFilterEntry  

bitSTORM-HP-160CfgBridgeProtocolFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.1.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeProtocolFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.3.1.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeProtocolFilter 1.3.6.1.4.1.5504.18.2.4.3.1.1.3
Tok_String
OBJECT-TYPE    
  INTEGER udp(17), tcp(6), ospf(89), igmp(2), igp(9), eigrp(88), ipinip(4), gre(47), icmp(1)  

bitSTORM-HP-160CfgBridgeProtocolFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.1.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeL4DstPortFilterTable 1.3.6.1.4.1.5504.18.2.4.3.2
The L4 dst filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeL4DstPortFilterEntry

bitSTORM-HP-160CfgBridgeL4DstPortFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.2.1
An Entry in the bitSTORM-HP-160CfgBridgeL4DstPortFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeL4DstPortFilterEntry  

bitSTORM-HP-160CfgBridgeL4DstPortFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.2.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeL4DstPortFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.3.2.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeL4DstPortFilterDestinationPort 1.3.6.1.4.1.5504.18.2.4.3.2.1.3
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeL4DstPortFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.2.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeSrcMacFilterTable 1.3.6.1.4.1.5504.18.2.4.3.3
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeSrcMacFilterEntry

bitSTORM-HP-160CfgBridgeSrcMacFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.3.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeSrcMacFilterEntry  

bitSTORM-HP-160BridgeSrcMacFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.3.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4095  

bitSTORM-HP-160BridgeSrcMacFilterBpIndex 1.3.6.1.4.1.5504.18.2.4.3.3.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgeSrcMacFilterSrcMac 1.3.6.1.4.1.5504.18.2.4.3.3.1.3
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160BridgeSrcMacFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.3.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeL4SrcPortFilterTable 1.3.6.1.4.1.5504.18.2.4.3.4
The L4 Src filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeL4SrcPortFilterEntry

bitSTORM-HP-160CfgBridgeL4SrcPortFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.4.1
An Entry in the bitSTORM-HP-160CfgBridgeL4SrcPortFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeL4SrcPortFilterEntry  

bitSTORM-HP-160CfgBridgeL4SrcPortFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.4.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeL4SrcPortFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.3.4.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeL4SrcPortFilterDestinationPort 1.3.6.1.4.1.5504.18.2.4.3.4.1.3
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeL4SrcPortFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.4.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeSrcIpFilterTable 1.3.6.1.4.1.5504.18.2.4.3.5
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeSrcIpFilterEntry

bitSTORM-HP-160CfgBridgeSrcIpFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.5.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeSrcIpFilterEntry  

bitSTORM-HP-160BridgeSrcIpFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.5.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4095  

bitSTORM-HP-160BridgeSrcIpFilterBpIndex 1.3.6.1.4.1.5504.18.2.4.3.5.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgeSrcIpFilterSrcIpStart 1.3.6.1.4.1.5504.18.2.4.3.5.1.3
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160BridgeSrcIpFilterSrcIpEnd 1.3.6.1.4.1.5504.18.2.4.3.5.1.4
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160BridgeSrcIpFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.5.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeDstIpFilterTable 1.3.6.1.4.1.5504.18.2.4.3.6
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeDstIpFilterEntry

bitSTORM-HP-160CfgBridgeDstIpFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.6.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeDstIpFilterEntry  

bitSTORM-HP-160BridgeDstIpFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.6.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4095  

bitSTORM-HP-160BridgeDstIpFilterBpIndex 1.3.6.1.4.1.5504.18.2.4.3.6.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgeDstIpFilterSrcIpStart 1.3.6.1.4.1.5504.18.2.4.3.6.1.3
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160BridgeDstIpFilterSrcIpEnd 1.3.6.1.4.1.5504.18.2.4.3.6.1.4
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160BridgeDstIpFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.6.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeNetBiosFilterTable 1.3.6.1.4.1.5504.18.2.4.3.7
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeNetBiosFilterEntry

bitSTORM-HP-160CfgBridgeNetBiosFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.7.1
An Entry in the bitSTORM-HP-160CfgBridgeNetBiosFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeNetBiosFilterEntry  

bitSTORM-HP-160CfgBridgeNetBiosFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.3.7.1.1
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeNetBiosFilterStatus 1.3.6.1.4.1.5504.18.2.4.3.7.1.2
Tok_String
OBJECT-TYPE    
  INTEGER enable(1), disable(0)  

bitSTORM-HP-160CfgBridgeNetBiosFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.7.1.3
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeArpBcastFilterTable 1.3.6.1.4.1.5504.18.2.4.3.8
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeArpBcastFilterEntry

bitSTORM-HP-160CfgBridgeArpBcastFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.8.1
An Entry in the bitSTORM-HP-160CfgBridgeArpBcastFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeArpBcastFilterEntry  

bitSTORM-HP-160CfgBridgeArpBcastFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.3.8.1.1
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeArpBcastFilterStatus 1.3.6.1.4.1.5504.18.2.4.3.8.1.2
Tok_String
OBJECT-TYPE    
  INTEGER enable(1), disable(0)  

bitSTORM-HP-160CfgBridgeArpBcastFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.8.1.3
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeAllowedIpFilterTable 1.3.6.1.4.1.5504.18.2.4.3.9
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeAllowedIpFilterEntry

bitSTORM-HP-160CfgBridgeAllowedIpFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.9.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeAllowedIpFilterEntry  

bitSTORM-HP-160BridgeAllowedIpFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.9.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..1920  

bitSTORM-HP-160BridgeAllowedIpFilterBpIndex 1.3.6.1.4.1.5504.18.2.4.3.9.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgeAllowedIpFilterIsDynamic 1.3.6.1.4.1.5504.18.2.4.3.9.1.3
Tok_String
OBJECT-TYPE    
  INTEGER manual(0), auto-learn(1)  

bitSTORM-HP-160BridgeAllowedIpFilterSrcIp 1.3.6.1.4.1.5504.18.2.4.3.9.1.4
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160BridgeAllowedIpFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.9.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeDstMacFilterTable 1.3.6.1.4.1.5504.18.2.4.3.10
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeDstMacFilterEntry

bitSTORM-HP-160CfgBridgeDstMacFilterEntry 1.3.6.1.4.1.5504.18.2.4.3.10.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeDstMacFilterEntry  

bitSTORM-HP-160BridgeDstMacFilterIndex 1.3.6.1.4.1.5504.18.2.4.3.10.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4095  

bitSTORM-HP-160BridgeDstMacFilterBpIndex 1.3.6.1.4.1.5504.18.2.4.3.10.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgeDstMacFilterDstMac 1.3.6.1.4.1.5504.18.2.4.3.10.1.3
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160BridgeDstMacFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.3.10.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgLACPMode 1.3.6.1.4.1.5504.18.2.4.4.1
System ID of LACP port.
OBJECT-TYPE    
  INTEGER on(1), off(0)  

bitSTORM-HP-160CfgIgmpMode 1.3.6.1.4.1.5504.18.2.4.5.1
Tok_String
OBJECT-TYPE    
  INTEGER snoopingMode(1), proxyMode(2)  

bitSTORM-HP-160CfgIgmpTimeoutQuery 1.3.6.1.4.1.5504.18.2.4.5.2
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpTimeoutUri 1.3.6.1.4.1.5504.18.2.4.5.3
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpTimeoutBc 1.3.6.1.4.1.5504.18.2.4.5.4
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpTimeoutMrt 1.3.6.1.4.1.5504.18.2.4.5.5
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpTimeoutLmqt 1.3.6.1.4.1.5504.18.2.4.5.6
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpTimeoutGmt 1.3.6.1.4.1.5504.18.2.4.5.7
Tok_String
OBJECT-TYPE    
  Integer32 1..500  

bitSTORM-HP-160CfgIgmpVersion 1.3.6.1.4.1.5504.18.2.4.5.8
Tok_String
OBJECT-TYPE    
  INTEGER igmpv1(1), igmpv2(2), igmpv3(3)  

bitSTORM-HP-160CfgIgmpAclMode 1.3.6.1.4.1.5504.18.2.4.5.9
Tok_String
OBJECT-TYPE    
  TruthValue true(1), false(2)  

bitSTORM-HP-160CfgIgmpLeaveMode 1.3.6.1.4.1.5504.18.2.4.5.10
Tok_String
OBJECT-TYPE    
  INTEGER normal(0), fast(1)  

bitSTORM-HP-160CfgIgmpGroupTable 1.3.6.1.4.1.5504.18.2.4.5.13
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160IgmpGroupEntry

bitSTORM-HP-160CfgIgmpGroupEntry 1.3.6.1.4.1.5504.18.2.4.5.13.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160IgmpGroupEntry  

bitSTORM-HP-160CfgIgmpGroupIp 1.3.6.1.4.1.5504.18.2.4.5.13.1.1
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgIgmpGroupVlan 1.3.6.1.4.1.5504.18.2.4.5.13.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160CfgIgmpGroupAddActions 1.3.6.1.4.1.5504.18.2.4.5.13.1.3
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgIgmpGroupNumOfEntries 1.3.6.1.4.1.5504.18.2.4.5.13.1.4
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgIgmpGroupInclude 1.3.6.1.4.1.5504.18.2.4.5.13.1.5
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgIgmpGroupBitmap 1.3.6.1.4.1.5504.18.2.4.5.13.1.6
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..513)  

bitSTORM-HP-160CfgIgmpSource 1.3.6.1.4.1.5504.18.2.4.5.14
OBJECT IDENTIFIER    

bitSTORM-HP-160CfgIgmpRouterPortTable 1.3.6.1.4.1.5504.18.2.4.5.15
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgIgmpRouterPortEntry

bitSTORM-HP-160CfgIgmpRouterPortEntry 1.3.6.1.4.1.5504.18.2.4.5.15.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgIgmpRouterPortEntry  

bitSTORM-HP-160CfgIgmpRouterPortVlanId 1.3.6.1.4.1.5504.18.2.4.5.15.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160CfgIgmpRouterPortBportIndex 1.3.6.1.4.1.5504.18.2.4.5.15.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgIgmpRouterPortBitmap 1.3.6.1.4.1.5504.18.2.4.5.15.1.3
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgIgmpRouterPortRouterIp 1.3.6.1.4.1.5504.18.2.4.5.15.1.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgIgmpRouterPortRouterReportIp 1.3.6.1.4.1.5504.18.2.4.5.15.1.5
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgIgmpRouterPortRowStatus 1.3.6.1.4.1.5504.18.2.4.5.15.1.6
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgIgmpAclProfileTable 1.3.6.1.4.1.5504.18.2.4.5.16
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgIgmpAclProfileEntry

bitSTORM-HP-160CfgIgmpAclProfileEntry 1.3.6.1.4.1.5504.18.2.4.5.16.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgIgmpAclProfileEntry  

bitSTORM-HP-160CfgIgmpAclProfileIndex 1.3.6.1.4.1.5504.18.2.4.5.16.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..24  

bitSTORM-HP-160CfgIgmpAclProfileChMap 1.3.6.1.4.1.5504.18.2.4.5.16.1.2
IP address total 1024 bytes. byte 1~256 for bank1 (64 ip address) byte 257~512 for bank2 (64 ip address) byte 513~768 for bank3 (64 ip address) byte 769~1024 for bank4 (64 ip address)
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgIgmpAclProfileVlanMap 1.3.6.1.4.1.5504.18.2.4.5.16.1.3
User (packet) VLAN id total 512 bytes. byte 1~128 for bank1 (64 vlan id) byte 129~256 for bank2 (64 vlan id) byte 257~384 for bank3 (64 vlan id) byte 385~512 for bank4 (64 vlan id)
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgIgmpAclProfileVlanEgressMap 1.3.6.1.4.1.5504.18.2.4.5.16.1.4
VlanEgressMap total 256 bytes. 1: tag, 2 : untag
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgIgmpAclProfileMcCount 1.3.6.1.4.1.5504.18.2.4.5.16.1.5
Max Channel Count
OBJECT-TYPE    
  Integer32 0..10  

bitSTORM-HP-160CfgIgmpAclProfileRowStatus 1.3.6.1.4.1.5504.18.2.4.5.16.1.6
Tok_String
OBJECT-TYPE    
  RowStatus active(1), notInService(2), notReady(3), createAndGo(4), createAndWait(5), destroy(6)  

bitSTORM-HP-160CfgIgmpAclProfileUsedCount 1.3.6.1.4.1.5504.18.2.4.5.16.1.7
The value is not zero means the profile is in used,then the profile can't be delete.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160CfgIgmpAclProfileMsgCount 1.3.6.1.4.1.5504.18.2.4.5.16.1.8
Max IGMP Message Count. Default value is 128.
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160CfgIgmpBridgePortBindTable 1.3.6.1.4.1.5504.18.2.4.5.17
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgIgmpBridgePortBindEntry

bitSTORM-HP-160CfgIgmpBridgePortBindEntry 1.3.6.1.4.1.5504.18.2.4.5.17.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgIgmpBridgePortBindEntry  

bitSTORM-HP-160CfgIgmpBindBpId 1.3.6.1.4.1.5504.18.2.4.5.17.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgIgmpBindProfileId 1.3.6.1.4.1.5504.18.2.4.5.17.1.2
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgRstpForceVersion 1.3.6.1.4.1.5504.18.2.4.6.1
Tok_String
OBJECT-TYPE    
  INTEGER stp(0), rstp(2)  

bitSTORM-HP-160StpEnable 1.3.6.1.4.1.5504.18.2.4.6.2
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), enabled(1)  

bitSTORM-HP-160CfgRstpPortTable 1.3.6.1.4.1.5504.18.2.4.6.3
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgRstpPortEntry

bitSTORM-HP-160CfgRstpPortEntry 1.3.6.1.4.1.5504.18.2.4.6.3.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgRstpPortEntry  

bitSTORM-HP-160CfgRstpPortIndex 1.3.6.1.4.1.5504.18.2.4.6.3.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgRstpPortAdminEdge 1.3.6.1.4.1.5504.18.2.4.6.3.1.2
Tok_String
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160CfgRstpPortAdminPoint2Point 1.3.6.1.4.1.5504.18.2.4.6.3.1.3
Tok_String
OBJECT-TYPE    
  INTEGER true(0), false(1), auto(2)  

bitSTORM-HP-160CfgRstpPortAdminNonSTP 1.3.6.1.4.1.5504.18.2.4.6.3.1.4
Tok_String
OBJECT-TYPE    
  INTEGER false(0), true(1)  

bitSTORM-HP-160StpBridgeID 1.3.6.1.4.1.5504.18.2.4.6.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160CfgDhcpMode 1.3.6.1.4.1.5504.18.2.4.7.1
Tok_String
OBJECT-TYPE    
  INTEGER transparent(0), relay(1), server(3)  

bitSTORM-HP-160CfgDhcpSubOptMode 1.3.6.1.4.1.5504.18.2.4.7.2
Tok_String
OBJECT-TYPE    
  INTEGER circuitID(1), remoteID(2), both(3)  

bitSTORM-HP-160CfgDhcpCircuitIdType 1.3.6.1.4.1.5504.18.2.4.7.3
default Set circuit default type scbv Set circuit scbv type scv Set circuit scv type sc Set circuit sc type customer Set circuit customer type
OBJECT-TYPE    
  INTEGER default(0), scbv(1), scv(2), sc(3), customer(4)  

bitSTORM-HP-160CfgDhcpName 1.3.6.1.4.1.5504.18.2.4.7.4
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgPppoeAcName 1.3.6.1.4.1.5504.18.2.4.7.5
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgPppoeSrvName 1.3.6.1.4.1.5504.18.2.4.7.6
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160CfgDhcpDslIdConfigTable 1.3.6.1.4.1.5504.18.2.4.7.8
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgDhcpDslIdConfigEntry

bitSTORM-HP-160CfgDhcpDslIdConfigEntry 1.3.6.1.4.1.5504.18.2.4.7.8.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgDhcpDslIdConfigEntry  

bitSTORM-HP-160CfgDhcpDslIfIndex 1.3.6.1.4.1.5504.18.2.4.7.8.1.1
IfIndex.
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgDslCircuitID 1.3.6.1.4.1.5504.18.2.4.7.8.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..63)  

bitSTORM-HP-160CfgDslRemoteID 1.3.6.1.4.1.5504.18.2.4.7.8.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..63)  

bitSTORM-HP-160CfgDslIdTrusted 1.3.6.1.4.1.5504.18.2.4.7.8.1.4
Tok_String
OBJECT-TYPE    
  TruthValue true(1), false(2)  

bitSTORM-HP-160CfgDslpppoeMode 1.3.6.1.4.1.5504.18.2.4.7.8.1.5
Tok_String
OBJECT-TYPE    
  INTEGER transparent(0), relay(1)  

bitSTORM-HP-160CfgDhcpServerProfileTable 1.3.6.1.4.1.5504.18.2.4.7.9
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgDhcpServerProfileEntry

bitSTORM-HP-160CfgDhcpServerProfileEntry 1.3.6.1.4.1.5504.18.2.4.7.9.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgDhcpServerProfileEntry  

bitSTORM-HP-160CfgDhcpServerPrfIndex 1.3.6.1.4.1.5504.18.2.4.7.9.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..24  

bitSTORM-HP-160CfgDhcpServerPrfStartIp 1.3.6.1.4.1.5504.18.2.4.7.9.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfEndIp 1.3.6.1.4.1.5504.18.2.4.7.9.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfIpMsk 1.3.6.1.4.1.5504.18.2.4.7.9.1.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfDefGatewayIp 1.3.6.1.4.1.5504.18.2.4.7.9.1.5
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfDNS1Ip 1.3.6.1.4.1.5504.18.2.4.7.9.1.6
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfDNS2Ip 1.3.6.1.4.1.5504.18.2.4.7.9.1.7
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160CfgDhcpServerPrfLeaseTime 1.3.6.1.4.1.5504.18.2.4.7.9.1.8
seconds
OBJECT-TYPE    
  Integer32 300..86400  

bitSTORM-HP-160CfgDhcpServerPrfUsedCount 1.3.6.1.4.1.5504.18.2.4.7.9.1.9
Tok_String
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160CfgDhcpServerPrfRowStatus 1.3.6.1.4.1.5504.18.2.4.7.9.1.10
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgDhcpServerProfileBindTable 1.3.6.1.4.1.5504.18.2.4.7.10
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgDhcpServerProfileBindEntry

bitSTORM-HP-160CfgDhcpServerProfileBindEntry 1.3.6.1.4.1.5504.18.2.4.7.10.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgDhcpServerProfileBindEntry  

bitSTORM-HP-160ServerBindBpIndex 1.3.6.1.4.1.5504.18.2.4.7.10.1.1
Tok_String
OBJECT-TYPE    
  Integer32 4..219  

bitSTORM-HP-160ServerBindPrfIndex 1.3.6.1.4.1.5504.18.2.4.7.10.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..24  

bitSTORM-HP-160CfgDhcpQueryClientTable 1.3.6.1.4.1.5504.18.2.4.7.11
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgDhcpQueryClientEntry

bitSTORM-HP-160CfgDhcpQueryClientEntry 1.3.6.1.4.1.5504.18.2.4.7.11.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgDhcpQueryClientEntry  

bitSTORM-HP-160ServerQueryBpIndex 1.3.6.1.4.1.5504.18.2.4.7.11.1.1
Tok_String
OBJECT-TYPE    
  Integer32 4..219  

bitSTORM-HP-160ServerQueryClientIndex 1.3.6.1.4.1.5504.18.2.4.7.11.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..10  

bitSTORM-HP-160ServerQueryIp 1.3.6.1.4.1.5504.18.2.4.7.11.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160ServerQueryMac 1.3.6.1.4.1.5504.18.2.4.7.11.1.4
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160ServerQueryExpTime 1.3.6.1.4.1.5504.18.2.4.7.11.1.5
Tok_String
OBJECT-TYPE    
  OCTET STRING  

bitSTORM-HP-160ServerQueryLeaseTime 1.3.6.1.4.1.5504.18.2.4.7.11.1.6
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgDhcpStaticIPTable 1.3.6.1.4.1.5504.18.2.4.7.12
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgDhcpStaticIPEntry

bitSTORM-HP-160CfgDhcpStaticIPEntry 1.3.6.1.4.1.5504.18.2.4.7.12.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgDhcpStaticIPEntry  

bitSTORM-HP-160StaticIndex 1.3.6.1.4.1.5504.18.2.4.7.12.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..438  

bitSTORM-HP-160StaticIPBpIndex 1.3.6.1.4.1.5504.18.2.4.7.12.1.2
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160StaticIp 1.3.6.1.4.1.5504.18.2.4.7.12.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..15)  

bitSTORM-HP-160StaticMac 1.3.6.1.4.1.5504.18.2.4.7.12.1.4
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160StaticRowStatus 1.3.6.1.4.1.5504.18.2.4.7.12.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgVpmtTrunkTable 1.3.6.1.4.1.5504.18.2.4.8.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgVpmtTrunkEntry

bitSTORM-HP-160CfgVpmtTrunkEntry 1.3.6.1.4.1.5504.18.2.4.8.1.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgVpmtTrunkEntry  

bitSTORM-HP-160CfgVpmtIndex 1.3.6.1.4.1.5504.18.2.4.8.1.1.1
1..3
OBJECT-TYPE    
  INTEGER 1..3  

bitSTORM-HP-160CfgVpmtPriority 1.3.6.1.4.1.5504.18.2.4.8.1.1.2
for priority 0..7 Queue No : 0 .. 3 0 .. 2 for shaping Queue(0 : High prio, 1 : Medium prio, 2 : Low prio) , the enetTrafficDescrType bind to this prio should be CIR/CIREIR/PPR. 3 only for WFQ Quese(Lowest prio of these 4 Queses) , the enetTrafficDescrType bind to this prio should be WFQ. It isn't allowed that a shaping Queue maps to enetTrafficDescrType WFQ It isn't allowed that a WFQ Queue maps to enetTrafficDescrType CIR/CIREIR/PPR OAMP Layer 2 will check the relationship of Queue mapping and enetTrafficDescrType.
OBJECT-TYPE    
  OCTET STRING Size(16)  

bitSTORM-HP-160CfgVpmtDenyMode 1.3.6.1.4.1.5504.18.2.4.8.1.1.3
0:pass, 1:deny
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160CfgVpmtBportProfileTable 1.3.6.1.4.1.5504.18.2.4.8.2
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgVpmtBportProfileEntry

bitSTORM-HP-160CfgVpmtBportProfileEntry 1.3.6.1.4.1.5504.18.2.4.8.2.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgVpmtBportProfileEntry  

bitSTORM-HP-160CfgVpmtProfileIndex 1.3.6.1.4.1.5504.18.2.4.8.2.1.1
1..3
OBJECT-TYPE    
  INTEGER 1..24  

bitSTORM-HP-160CfgVpmtProfilePriority 1.3.6.1.4.1.5504.18.2.4.8.2.1.2
for priority 0..7 Queue No : 0 .. 3 0 .. 2 for shaping Queue(0 : High prio, 1 : Medium prio, 2 : Low prio) , the enetTrafficDescrType bind to this prio should be CIR/CIREIR/PPR. 3 only for WFQ Quese(Lowest prio of these 4 Queses) , the enetTrafficDescrType bind to this prio should be WFQ. It isn't allowed that a shaping Queue maps to enetTrafficDescrType WFQ It isn't allowed that a WFQ Queue maps to enetTrafficDescrType CIR/CIREIR/PPR OAMP Layer 2 will check the relationship of Queue mapping and enetTrafficDescrType.
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160CfgVpmtProfileDenyMode 1.3.6.1.4.1.5504.18.2.4.8.2.1.3
0:pass, 1:deny
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160CfgVpmtProfileEnetProfileIndex 1.3.6.1.4.1.5504.18.2.4.8.2.1.4
enet traffic descriptor index.
OBJECT-TYPE    
  OCTET STRING Size(8)  

bitSTORM-HP-160CfgVpmtProfileUsedCount 1.3.6.1.4.1.5504.18.2.4.8.2.1.5
Tok_String
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160CfgVpmtProfileRowStatus 1.3.6.1.4.1.5504.18.2.4.8.2.1.6
bitSTORM-HP-160CfgVpmtRowStatus.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgVpmtBridgePortBindTable 1.3.6.1.4.1.5504.18.2.4.8.3
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgVpmtBridgePortBindEntry

bitSTORM-HP-160CfgVpmtBridgePortBindEntry 1.3.6.1.4.1.5504.18.2.4.8.3.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgVpmtBridgePortBindEntry  

bitSTORM-HP-160CfgVpmtBindBpId 1.3.6.1.4.1.5504.18.2.4.8.3.1.1
Tok_String
OBJECT-TYPE    
  Integer32 196..219  

bitSTORM-HP-160CfgVpmtBindProfileId 1.3.6.1.4.1.5504.18.2.4.8.3.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..24  

bitSTORM-HP-160CfgSystemExtEtherType 1.3.6.1.4.1.5504.18.2.4.9.1
Tok_String
OBJECT-TYPE    
  Integer32 0..65535  

bitSTORM-HP-160CfgSystemAllowDownstreamBc 1.3.6.1.4.1.5504.18.2.4.9.2
0:disable(only ARP,DHCP are allowed), 1:enable(ALL bccast are allowed)
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgSystemAddAllowIpBySnoopDHCP 1.3.6.1.4.1.5504.18.2.4.9.3
0:disable, 1:enable, allowIpFilter should be enabled first.
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgSystemAgingTimePerPort 1.3.6.1.4.1.5504.18.2.4.9.4
1:enable, 0:disable->Old mechanism, referecne to TpAgingTime.
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgSystemReplaceArpMac 1.3.6.1.4.1.5504.18.2.4.9.5
0:disable, 1:enable(mac of arp will be replaced)
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgSystemSnoopArpDefaultGatewayMac 1.3.6.1.4.1.5504.18.2.4.9.6
string hex mac format in DB, example->FF:FF:FF:FF:FF:FF
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160CfgSystemArpSpoofing 1.3.6.1.4.1.5504.18.2.4.9.7
0:disable this arp spoof function, L2 will not check the arp reply packet from line side. 1:enable this arp spoof function, L2 will check the arp reply packet from line side.
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgSystemAntiMacSpoofing 1.3.6.1.4.1.5504.18.2.4.9.8
0:able to provide service to users with duplicate MAC addresses (by default) 1:able to deny service to users with duplicate MAC addresses.
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgAclService 1.3.6.1.4.1.5504.18.2.4.13.1
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgPppoeService 1.3.6.1.4.1.5504.18.2.4.13.2
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgFilterAndPriorityRemarkService 1.3.6.1.4.1.5504.18.2.4.13.3
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgRateLimitService 1.3.6.1.4.1.5504.18.2.4.13.4
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgStackVlanService 1.3.6.1.4.1.5504.18.2.4.13.5
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgNetBiosDenialService 1.3.6.1.4.1.5504.18.2.4.13.6
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgAllowIpService 1.3.6.1.4.1.5504.18.2.4.13.7
Tok_String
OBJECT-TYPE    
  INTEGER disable(0), enable(1)  

bitSTORM-HP-160CfgClusterName 1.3.6.1.4.1.5504.18.2.7.1.1
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160CfgClusterDomain 1.3.6.1.4.1.5504.18.2.7.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(0..32)  

bitSTORM-HP-160CfgClusterManagementIp 1.3.6.1.4.1.5504.18.2.7.1.3
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgClusterManagementNetmask 1.3.6.1.4.1.5504.18.2.7.1.4
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgClusterManagementGateway 1.3.6.1.4.1.5504.18.2.7.1.5
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160CfgClusterPriority 1.3.6.1.4.1.5504.18.2.7.1.6
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgClusterClustered 1.3.6.1.4.1.5504.18.2.7.1.7
Tok_String
OBJECT-TYPE    
  INTEGER disabled(0), enabled(1)  

bitSTORM-HP-160CfgClusterSlaveOnly 1.3.6.1.4.1.5504.18.2.7.1.8
Tok_String
OBJECT-TYPE    
  INTEGER masterslave(0), slaveonly(1)  

bitSTORM-HP-160CfgClusterState 1.3.6.1.4.1.5504.18.2.7.1.9
Tok_String
OBJECT-TYPE    
  INTEGER idle(0), reinit(1), discovering(2), requesting(3), voting(4), slave(5), master(6)  

bitSTORM-HP-160CfgEnetTrafficDescrEntry 1.3.6.1.4.1.5504.18.2.8.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgEnetTrafficDescrEntry  

bitSTORM-HP-160CfgEnetTrafficDescrIndex 1.3.6.1.4.1.5504.18.2.8.1.1
1..16
OBJECT-TYPE    
  Integer32 1..16  

bitSTORM-HP-160CfgEnetTrafficType 1.3.6.1.4.1.5504.18.2.8.1.2
ENETPKTSHAPINGWFQ(1), ENETPKTSHAPINGPPR(2), ENETPKTSHAPINGCIR(3), ENETPKTSHAPINGCIREIR(4)
OBJECT-TYPE    
  BITSTORM-HP-160EnetTrafficType  

bitSTORM-HP-160CfgEnetTrafficWeight 1.3.6.1.4.1.5504.18.2.8.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..42  

bitSTORM-HP-160CfgEnetTrafficPPR 1.3.6.1.4.1.5504.18.2.8.1.4
Peak packet Rate.[bits/second]
OBJECT-TYPE    
  Unsigned32 1000000..100000000  

bitSTORM-HP-160CfgEnetTrafficCIR 1.3.6.1.4.1.5504.18.2.8.1.5
Committed Information Rate expressed as bits/sec
OBJECT-TYPE    
  Unsigned32 1000000..100000000  

bitSTORM-HP-160CfgEnetTrafficEIR 1.3.6.1.4.1.5504.18.2.8.1.6
Committed Excess Rate expressed as bits/sec
OBJECT-TYPE    
  Unsigned32 1000000..100000000  

bitSTORM-HP-160CfgEnetTrafficCBS 1.3.6.1.4.1.5504.18.2.8.1.7
Committed Burst Size in bits
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160CfgEnetTrafficEBS 1.3.6.1.4.1.5504.18.2.8.1.8
Excess Burst Size in bits
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160CfgEnetTrafficPPRPollingSpeed 1.3.6.1.4.1.5504.18.2.8.1.9
Vaule range:1000000-100000000. 2147483648 means Auto Deactivation Mode.
OBJECT-TYPE    
  Unsigned32 1000000..2147483648  

bitSTORM-HP-160CfgEnetTrafficCIRPollingSpeed 1.3.6.1.4.1.5504.18.2.8.1.10
Vaule range:1000000-100000000.. 2147483648 means Auto Deactivation Mode. Currently, Auto Deactivation is not supported.
OBJECT-TYPE    
  Unsigned32 1000000..2147483648  

bitSTORM-HP-160CfgEnetTrafficEIRPollingSpeed 1.3.6.1.4.1.5504.18.2.8.1.11
Vaule range:1000000-100000000. 2147483648 means Auto Deactivation Mode. Currently only Auto-deactivation mode is permitted.
OBJECT-TYPE    
  Unsigned32 1000000..2147483648  

bitSTORM-HP-160CfgAtmTrafficType 1.3.6.1.4.1.5504.18.2.8.1.12
AtmPolicingCBR(9), AtmPolicingUBR2(11)
OBJECT-TYPE    
  BITSTORM-HP-160AtmTrafficType  

bitSTORM-HP-160CfgEnetTrafficPCR 1.3.6.1.4.1.5504.18.2.8.1.13
0-65536, Specified in units of cells/second
OBJECT-TYPE    
  Unsigned32 1..65536  

bitSTORM-HP-160CfgEnetTrafficCDVT 1.3.6.1.4.1.5504.18.2.8.1.14
0-65536, Specified in units of 10 ns increments, this field is used by the PCR policing algorithm
OBJECT-TYPE    
  Unsigned32 1..65536  

bitSTORM-HP-160CfgEnetTrafficRowStatus 1.3.6.1.4.1.5504.18.2.8.1.15
bitSTORM-HP-160CfgEnetTrafficRowStatus.
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgEnetTrafficUsedCount 1.3.6.1.4.1.5504.18.2.8.1.16
The value is not zero means the profile is in used,then the profile can't be delete.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160MtnRemoteFTPServerIP 1.3.6.1.4.1.5504.18.4.3.1.1
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160MtnRemoteFTPUserName 1.3.6.1.4.1.5504.18.4.3.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160MtnRemoteFTPPassword 1.3.6.1.4.1.5504.18.4.3.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160MtnRemoteFTPFileName 1.3.6.1.4.1.5504.18.4.3.1.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(64)  

bitSTORM-HP-160MtnCliCfgFTPServerIP 1.3.6.1.4.1.5504.18.4.7.1.1
Tok_String
OBJECT-TYPE    
  TAddress  

bitSTORM-HP-160MtnCliCfgFTPUserName 1.3.6.1.4.1.5504.18.4.7.1.2
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160MtnCliCfgFTPPassword 1.3.6.1.4.1.5504.18.4.7.1.3
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(32)  

bitSTORM-HP-160MtnCliCfgFTPFileName 1.3.6.1.4.1.5504.18.4.7.1.4
Tok_String
OBJECT-TYPE    
  OCTET STRING Size(64)  

bitSTORM-HP-160SystemAlarmTrap 1.3.6.1.4.1.5504.18.7.1.1.1
OBJECT IDENTIFIER    

bitSTORM-HP-160GBEAlarmTrap 1.3.6.1.4.1.5504.18.7.1.1.2
OBJECT IDENTIFIER    

bitSTORM-HP-160VDSLAlarmTrap 1.3.6.1.4.1.5504.18.7.1.1.3
OBJECT IDENTIFIER    

bitSTORM-HP-160SystemEventTrap 1.3.6.1.4.1.5504.18.7.1.2.1
OBJECT IDENTIFIER    

bitSTORM-HP-160ATMEventTrap 1.3.6.1.4.1.5504.18.7.1.2.2
OBJECT IDENTIFIER    

bitSTORM-HP-160XDSLEventTrap 1.3.6.1.4.1.5504.18.7.1.2.3
OBJECT IDENTIFIER    

bitSTORM-HP-160VDSLEventTrap 1.3.6.1.4.1.5504.18.7.1.2.4
OBJECT IDENTIFIER    

bitSTORM-HP-160McBcRateLimitTable 1.3.6.1.4.1.5504.18.2.4.2.6.1
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160McBcRateLimitEntry

bitSTORM-HP-160McBcRateLimitEntry 1.3.6.1.4.1.5504.18.2.4.2.6.1.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160McBcRateLimitEntry  

bitSTORM-HP-160McBcRateLimitVlanId 1.3.6.1.4.1.5504.18.2.4.2.6.1.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160McBcRateLimitCIR 1.3.6.1.4.1.5504.18.2.4.2.6.1.1.2
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160McBcRateLimitLbSl 1.3.6.1.4.1.5504.18.2.4.2.6.1.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160McBcRateLimitRowStatus 1.3.6.1.4.1.5504.18.2.4.2.6.1.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160McFldRateLimitTable 1.3.6.1.4.1.5504.18.2.4.2.6.2
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160McFldRateLimitEntry

bitSTORM-HP-160McFldRateLimitEntry 1.3.6.1.4.1.5504.18.2.4.2.6.2.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160McFldRateLimitEntry  

bitSTORM-HP-160McFldRateLimitVlanId 1.3.6.1.4.1.5504.18.2.4.2.6.2.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160McFldRateLimitCIR 1.3.6.1.4.1.5504.18.2.4.2.6.2.1.2
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160McFldRateLimitLbSl 1.3.6.1.4.1.5504.18.2.4.2.6.2.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160McFldRateLimitRowStatus 1.3.6.1.4.1.5504.18.2.4.2.6.2.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160IwPolicerTable 1.3.6.1.4.1.5504.18.2.4.2.6.3
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160IwPolicerEntry

bitSTORM-HP-160IwpolicerEntry 1.3.6.1.4.1.5504.18.2.4.2.6.3.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160IwPolicerEntry  

bitSTORM-HP-160IwPolicerIndex 1.3.6.1.4.1.5504.18.2.4.2.6.3.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..128  

bitSTORM-HP-160IwPolicerCIR 1.3.6.1.4.1.5504.18.2.4.2.6.3.1.2
Tok_String
OBJECT-TYPE    
  Unsigned32  

bitSTORM-HP-160IwPolicerLbSl 1.3.6.1.4.1.5504.18.2.4.2.6.3.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160IwPolicerRowStatus 1.3.6.1.4.1.5504.18.2.4.2.6.3.1.4
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160IwPolicerUsedCount 1.3.6.1.4.1.5504.18.2.4.2.6.3.1.5
The value is not zero means the profile is in used,then the profile can't be delete.
OBJECT-TYPE    
  INTEGER  

bitSTORM-HP-160BportRateLimitTable 1.3.6.1.4.1.5504.18.2.4.2.6.4
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BportRateLimitEntry

bitSTORM-HP-160BportRateLimitEntry 1.3.6.1.4.1.5504.18.2.4.2.6.4.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BportRateLimitEntry  

bitSTORM-HP-160BportIfcIndex 1.3.6.1.4.1.5504.18.2.4.2.6.4.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..219  

bitSTORM-HP-160BportRateLimitEgressIwPolicerIdx 1.3.6.1.4.1.5504.18.2.4.2.6.4.1.2
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160BportRateLimitIngressIwPolicerIdx 1.3.6.1.4.1.5504.18.2.4.2.6.4.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160BportVlanRateLimitTable 1.3.6.1.4.1.5504.18.2.4.2.6.5
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BportVlanRateLimitEntry

bitSTORM-HP-160BportVlanRateLimitEntry 1.3.6.1.4.1.5504.18.2.4.2.6.5.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BportVlanRateLimitEntry  

bitSTORM-HP-160BportVlanRateLimitIndex 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..219  

bitSTORM-HP-160BportVlanRateLimitEgressIwPolicerIdx 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.2
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160BportVlanRateLimitIngressIwPolicerIdx 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.3
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4294967295  

bitSTORM-HP-160BportVlanRateLimitVlanId 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.4
Tok_String
OBJECT-TYPE    
  Unsigned32 1..4094  

bitSTORM-HP-160BportVlanRateLimitIfcIndex 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.5
Tok_String
OBJECT-TYPE    
  Unsigned32 1..219  

bitSTORM-HP-160BportVlanRateLimitRowStatus 1.3.6.1.4.1.5504.18.2.4.2.6.5.1.6
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160BportPortBcRateLimitTable 1.3.6.1.4.1.5504.18.2.4.2.6.6
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BportPortBcRateLimitEntry

bitSTORM-HP-160BportPortBcRateLimitEntry 1.3.6.1.4.1.5504.18.2.4.2.6.6.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BportPortBcRateLimitEntry  

bitSTORM-HP-160bcRateBridgePortIfcIndex 1.3.6.1.4.1.5504.18.2.4.2.6.6.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..219  

bitSTORM-HP-160bcRateLimitIngressIwPolicerIdx 1.3.6.1.4.1.5504.18.2.4.2.6.6.1.2
Tok_String
OBJECT-TYPE    
  Integer32 1..128  

bitSTORM-HP-160BportVlanTranslationTable 1.3.6.1.4.1.5504.18.2.4.2.8
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160BportVlanTranslationEntry

bitSTORM-HP-160BportVlanTranslationEntry 1.3.6.1.4.1.5504.18.2.4.2.8.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160BportVlanTranslationEntry  

bitSTORM-HP-160BportVlanTranslationIndex 1.3.6.1.4.1.5504.18.2.4.2.8.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..512  

bitSTORM-HP-160BportVlanTranslationUserPort 1.3.6.1.4.1.5504.18.2.4.2.8.1.2
Tok_String
OBJECT-TYPE    
  Integer32 4..219  

bitSTORM-HP-160BportVlanTranslationUserVlanId 1.3.6.1.4.1.5504.18.2.4.2.8.1.3
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160BportVlanTranslationUplinkPort 1.3.6.1.4.1.5504.18.2.4.2.8.1.4
Tok_String
OBJECT-TYPE    
  Integer32 1..3  

bitSTORM-HP-160BportVlanTranslationUplinkVlanId 1.3.6.1.4.1.5504.18.2.4.2.8.1.5
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160BportVlanTranslationUplinkPriority 1.3.6.1.4.1.5504.18.2.4.2.8.1.6
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160BportVlanTranslationRowStatus 1.3.6.1.4.1.5504.18.2.4.2.8.1.7
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeTosVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.1
The TOS filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeTosVpmtFilterEntry

bitSTORM-HP-160CfgBridgeTosVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.1.1
An Entry in the bitSTORM-HP-160CfgBridgeTosVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeTosVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeTosVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.1.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeTosVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.1.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeTosVpmtFilterIncomingTos 1.3.6.1.4.1.5504.18.2.4.2.7.1.1.3
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeTosVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.1.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeTosVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.1.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeDSVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.2
The DS filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeDSVpmtFilterEntry

bitSTORM-HP-160CfgBridgeDSVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.2.1
An Entry in the bitSTORM-HP-160CfgBridgeDSVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeDSVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeDSVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.2.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..256  

bitSTORM-HP-160CfgBridgeDSVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.2.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeDSVpmtFilterIncomingDS 1.3.6.1.4.1.5504.18.2.4.2.7.2.1.3
DIFFSERV-DEFAULT(0) DIFFSERV-AF11(10) DIFFSERV-AF12(12) DIFFSERV-AF13(14) DIFFSERV-AF21(18) DIFFSERV-AF22(20) DIFFSERV-AF23(22) DIFFSERV-AF31(26) DIFFSERV-AF32(28) DIFFSERV-AF33(30) DIFFSERV-AF41(34) DIFFSERV-AF42(36) DIFFSERV-AF43(38) DIFFSERV-EF(46)
OBJECT-TYPE    
  Integer32 diffserv-default(0), diffserv-af11(10), diffserv-af12(12), diffserv-af13(14), diffserv-af21(18), diffserv-af22(20), diffserv-af23(22), diffserv-af31(26), diffserv-af32(28), diffserv-af33(30), diffserv-af41(34), diffserv-af42(36), diffserv-af43(38), diffserv-ef(46)  

bitSTORM-HP-160CfgBridgeDSVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.2.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeDSVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.2.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.3
The IP src filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeIpSrcVpmtFilterEntry

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.3.1
An Entry in the bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeIpSrcVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIncomingIpsrcstart 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.3
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterIncomingIpsrcend 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.4
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.5
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeIpSrcVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.3.1.6
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.4
The IP dst filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeIpDstVpmtFilterEntry

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.4.1
An Entry in the bitSTORM-HP-160CfgBridgeIpDstVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeIpDstVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIncomingIpDststart 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.3
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterIncomingIpDstend 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.4
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.5
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeIpDstVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.4.1.6
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.5
The MAC src filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeMacSrcVpmtFilterEntry

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.5.1
An Entry in the bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeMacSrcVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.5.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.5.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterIncomingMacsrc 1.3.6.1.4.1.5504.18.2.4.2.7.5.1.3
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.5.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeMacSrcVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.5.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.6
The MAC dst filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeMacDstVpmtFilterEntry

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.6.1
An Entry in the bitSTORM-HP-160CfgBridgeMacDstVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeMacDstVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.6.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.6.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterIncomingMacDst 1.3.6.1.4.1.5504.18.2.4.2.7.6.1.3
Tok_String
OBJECT-TYPE    
  PhysAddress  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.6.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeMacDstVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.6.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.7
The Vlan ID filter configuration table.
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgeVlanIdVpmtFilterEntry

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.7.1
An Entry in the bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterTable
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgeVlanIdVpmtFilterEntry  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.7.1.1
Tok_String
OBJECT-TYPE    
  Integer32  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.7.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterIncomingVlanid 1.3.6.1.4.1.5504.18.2.4.2.7.7.1.3
Tok_String
OBJECT-TYPE    
  Integer32 0..4094  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.7.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160CfgBridgeVlanIdVpmtFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.7.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgBridgePrioTagFilterTable 1.3.6.1.4.1.5504.18.2.4.2.7.8
Tok_String
OBJECT-TYPE    
  SEQUENCE OF  
    BITSTORM-HP-160CfgBridgePrioTagFilterEntry

bitSTORM-HP-160CfgBridgePrioTagFilterEntry 1.3.6.1.4.1.5504.18.2.4.2.7.8.1
Tok_String
OBJECT-TYPE    
  BITSTORM-HP-160CfgBridgePrioTagFilterEntry  

bitSTORM-HP-160BridgePrioTagFilterIndex 1.3.6.1.4.1.5504.18.2.4.2.7.8.1.1
Tok_String
OBJECT-TYPE    
  Integer32 1..4095  

bitSTORM-HP-160BridgePrioTagInputBridgePort 1.3.6.1.4.1.5504.18.2.4.2.7.8.1.2
Tok_String
OBJECT-TYPE    
  InterfaceIndex  

bitSTORM-HP-160BridgePrioTagOutgoingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.8.1.3
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160BridgePrioTagIncomingVlanPriority 1.3.6.1.4.1.5504.18.2.4.2.7.8.1.4
Tok_String
OBJECT-TYPE    
  Integer32 0..7  

bitSTORM-HP-160BridgePrioTagFilterRowStatus 1.3.6.1.4.1.5504.18.2.4.2.7.8.1.5
Tok_String
OBJECT-TYPE    
  RowStatus  

bitSTORM-HP-160CfgIgmpSourceGroupIp 1.3.6.1.4.1.5504.18.2.4.5.14.1
Tok_String
OBJECT-TYPE    
  IpAddress  

bitSTORM-HP-160CfgIgmpSourceGroupVlan 1.3.6.1.4.1.5504.18.2.4.5.14.2
Tok_String
OBJECT-TYPE    
  Integer32 1..4094  

bitSTORM-HP-160TrapAlmSystemHousekeep1 1.3.6.1.4.1.5504.18.7.1.1.1.1
DSLAM system housekeeping1 trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemHousekeep2 1.3.6.1.4.1.5504.18.7.1.1.1.2
DSLAM system housekeeping2 trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemHousekeep3 1.3.6.1.4.1.5504.18.7.1.1.1.3
DSLAM system housekeeping3 trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemHousekeep4 1.3.6.1.4.1.5504.18.7.1.1.1.4
DSLAM system housekeeping4 trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemFanFailure 1.3.6.1.4.1.5504.18.7.1.1.1.5
DSLAM fan failure alarm trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemSelfTestTestFail 1.3.6.1.4.1.5504.18.7.1.1.1.6
DSLAM system module test fail trap.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemAboveTemperature 1.3.6.1.4.1.5504.18.7.1.1.1.7
The current temperature exceeds bitSTORM-HP-160SysTemperatureUpShfThreshold.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmSystemBelowTemperature 1.3.6.1.4.1.5504.18.7.1.1.1.8
The current temperature descends below to bitSTORM-HP-160SysTemperatureDwShfThreshold.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOF 1.3.6.1.4.1.5504.18.7.1.1.3.1
Loss of frame of the DSLAM VDSL interface.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOS 1.3.6.1.4.1.5504.18.7.1.1.3.2
Loss of signal of the DSLAM VDSL interface.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOSQ 1.3.6.1.4.1.5504.18.7.1.1.3.3
Loss of signal quality of the DSLAM VDSL interface.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOL 1.3.6.1.4.1.5504.18.7.1.1.3.4
Loss of link of the DSLAM VDSL interface.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslInitFailure 1.3.6.1.4.1.5504.18.7.1.1.3.5
VDSL Init Failure.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslESE 1.3.6.1.4.1.5504.18.7.1.1.3.8
VDSL Excessive Severely Errored Seconds of the VDSL interface.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslNCDSlow 1.3.6.1.4.1.5504.18.7.1.1.3.9
VDSL No Cell Delination on the slow channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLCDSlow 1.3.6.1.4.1.5504.18.7.1.1.3.10
VDSL Loss of Cell Delination on the slow channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslNCDFast 1.3.6.1.4.1.5504.18.7.1.1.3.11
VDSL No Cell Delination on the fast channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLCDFast 1.3.6.1.4.1.5504.18.7.1.1.3.12
VDSL Loss of Cell Delination on the fast channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOFFE 1.3.6.1.4.1.5504.18.7.1.1.3.13
Loss of frame in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOSFE 1.3.6.1.4.1.5504.18.7.1.1.3.14
Loss of signal in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLPRFE 1.3.6.1.4.1.5504.18.7.1.1.3.15
Loss of power in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLOSQFE 1.3.6.1.4.1.5504.18.7.1.1.3.16
Loss of signal quality in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslNoPeerVtuPresentFE 1.3.6.1.4.1.5504.18.7.1.1.3.17
VDSL No Peer Vtu Present in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslESEFE 1.3.6.1.4.1.5504.18.7.1.1.3.18
VDSL Excessive Severely Errored Seconds in the downstream direction.
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslNCDSlowFE 1.3.6.1.4.1.5504.18.7.1.1.3.19
VDSL FE No Cell Delination on the slow channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLCDSlowFE 1.3.6.1.4.1.5504.18.7.1.1.3.20
VDSL FE Loss of Cell Delination on the slow channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslNCDFastFE 1.3.6.1.4.1.5504.18.7.1.1.3.21
VDSL FE No Cell Delination on the fast channel
NOTIFICATION-TYPE    

bitSTORM-HP-160TrapAlmVdslLCDFastFE 1.3.6.1.4.1.5504.18.7.1.1.3.22
VDSL FE Loss of Cell Delination on the fast channel
NOTIFICATION-TYPE